# Copyright 2016 by Peter Cock.  All rights reserved.
# This code is part of the Biopython distribution and governed by its
# license.  Please see the LICENSE file that should have been included
# as part of this package.

"""Bio.Align.AlignInfo related tests."""
import unittest

from Bio.Alphabet import DNAAlphabet, generic_protein
from Bio.Alphabet import HasStopCodon, Gapped
from Bio.Alphabet.IUPAC import unambiguous_dna
from Bio.Align import MultipleSeqAlignment
from Bio.Seq import Seq
from Bio.SeqRecord import SeqRecord
from Bio import AlignIO
from Bio.SubsMat.FreqTable import FreqTable, FREQ
from Bio.Align.AlignInfo import SummaryInfo
import math


class AlignInfoTests(unittest.TestCase):
    """Test basic usage."""

    def assertAlmostEqualList(self, list1, list2, **kwargs):
        self.assertEqual(len(list1), len(list2))
        for (v1, v2) in zip(list1, list2):
            self.assertAlmostEqual(v1, v2, **kwargs)

    def test_nucleotides(self):
        filename = "GFF/multi.fna"
        format = "fasta"
        alignment = AlignIO.read(filename, format, alphabet=unambiguous_dna)
        summary = SummaryInfo(alignment)

        c = summary.dumb_consensus(ambiguous="N")
        self.assertEqual(str(c), "NNNNNNNN")
        self.assertNotEqual(c.alphabet, unambiguous_dna)
        self.assertIsInstance(c.alphabet, DNAAlphabet)

        c = summary.gap_consensus(ambiguous="N")
        self.assertEqual(str(c), "NNNNNNNN")
        self.assertNotEqual(c.alphabet, unambiguous_dna)
        self.assertIsInstance(c.alphabet, DNAAlphabet)

        expected = FreqTable({"A": 0.25, "G": 0.25, "T": 0.25, "C": 0.25},
                             FREQ, unambiguous_dna)

        m = summary.pos_specific_score_matrix(chars_to_ignore=["-"],
                                              axis_seq=c)
        self.assertEqual(str(m), """    A   C   G   T
N  2.0 0.0 1.0 0.0
N  1.0 1.0 1.0 0.0
N  1.0 0.0 2.0 0.0
N  0.0 1.0 1.0 1.0
N  1.0 2.0 0.0 0.0
N  0.0 2.0 1.0 0.0
N  1.0 2.0 0.0 0.0
N  0.0 2.0 1.0 0.0
""")

        # Have a generic alphabet, without a declared gap char, so must tell
        # provide the frequencies and chars to ignore explicitly.
        ic = summary.information_content(e_freq_table=expected,
                                         chars_to_ignore=["-"])
        self.assertAlmostEqual(ic, 7.32029999423075, places=6)

    def test_proteins(self):
        alpha = HasStopCodon(Gapped(generic_protein, "-"), "*")
        a = MultipleSeqAlignment([
            SeqRecord(Seq("MHQAIFIYQIGYP*LKSGYIQSIRSPEYDNW-", alpha), id="ID001"),
            SeqRecord(Seq("MH--IFIYQIGYAYLKSGYIQSIRSPEY-NW*", alpha), id="ID002"),
            SeqRecord(Seq("MHQAIFIYQIGYPYLKSGYIQSIRSPEYDNW*", alpha), id="ID003")])
        self.assertEqual(32, a.get_alignment_length())

        s = SummaryInfo(a)

        c = s.dumb_consensus(ambiguous="X")
        self.assertEqual(str(c), "MHQAIFIYQIGYXXLKSGYIQSIRSPEYDNW*")

        c = s.gap_consensus(ambiguous="X")
        self.assertEqual(str(c), "MHXXIFIYQIGYXXLKSGYIQSIRSPEYXNWX")

        m = s.pos_specific_score_matrix(chars_to_ignore=["-", "*"], axis_seq=c)
        self.assertEqual(str(m), """    A   D   E   F   G   H   I   K   L   M   N   P   Q   R   S   W   Y
M  0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 3.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0
H  0.0 0.0 0.0 0.0 0.0 3.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0
X  0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 2.0 0.0 0.0 0.0 0.0
X  2.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0
I  0.0 0.0 0.0 0.0 0.0 0.0 3.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0
F  0.0 0.0 0.0 3.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0
I  0.0 0.0 0.0 0.0 0.0 0.0 3.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0
Y  0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 3.0
Q  0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 3.0 0.0 0.0 0.0 0.0
I  0.0 0.0 0.0 0.0 0.0 0.0 3.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0
G  0.0 0.0 0.0 0.0 3.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0
Y  0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 3.0
X  1.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 2.0 0.0 0.0 0.0 0.0 0.0
X  0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 2.0
L  0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 3.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0
K  0.0 0.0 0.0 0.0 0.0 0.0 0.0 3.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0
S  0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 3.0 0.0 0.0
G  0.0 0.0 0.0 0.0 3.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0
Y  0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 3.0
I  0.0 0.0 0.0 0.0 0.0 0.0 3.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0
Q  0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 3.0 0.0 0.0 0.0 0.0
S  0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 3.0 0.0 0.0
I  0.0 0.0 0.0 0.0 0.0 0.0 3.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0
R  0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 3.0 0.0 0.0 0.0
S  0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 3.0 0.0 0.0
P  0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 3.0 0.0 0.0 0.0 0.0 0.0
E  0.0 0.0 3.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0
Y  0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 3.0
X  0.0 2.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0
N  0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 3.0 0.0 0.0 0.0 0.0 0.0 0.0
W  0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 3.0 0.0
X  0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0
""")

        ic = s.information_content(chars_to_ignore=["-", "*"])
        self.assertAlmostEqual(ic, 133.061475107, places=6)

    def test_pseudo_count(self):
        # use example from
        # http://biologie.univ-mrs.fr/upload/p202/01.4.PSSM_theory.pdf
        alpha = unambiguous_dna
        dna_align = MultipleSeqAlignment([
            SeqRecord(Seq("AACCACGTTTAA", alpha), id="ID001"),
            SeqRecord(Seq("CACCACGTGGGT", alpha), id="ID002"),
            SeqRecord(Seq("CACCACGTTCGC", alpha), id="ID003"),
            SeqRecord(Seq("GCGCACGTGGGG", alpha), id="ID004"),
            SeqRecord(Seq("TCGCACGTTGTG", alpha), id="ID005"),
            SeqRecord(Seq("TGGCACGTGTTT", alpha), id="ID006"),
            SeqRecord(Seq("TGACACGTGGGA", alpha), id="ID007"),
            SeqRecord(Seq("TTACACGTGCGC", alpha), id="ID008")])

        summary = SummaryInfo(dna_align)
        expected = FreqTable({"A": 0.325, "G": 0.175, "T": 0.325, "C": 0.175},
                             FREQ, unambiguous_dna)
        ic = summary.information_content(e_freq_table=expected,
                                         log_base=math.exp(1),
                                         pseudo_count=1)
        self.assertAlmostEqualList(summary.ic_vector, [0.110, 0.090, 0.360, 1.290,
                                                       0.800, 1.290, 1.290, 0.80,
                                                       0.610, 0.390, 0.470, 0.040],
                                   places=2)
        self.assertAlmostEqual(ic, 7.546, places=3)


if __name__ == "__main__":
    runner = unittest.TextTestRunner(verbosity=2)
    unittest.main(testRunner=runner)
