R5HY77 R5HY77_9BACT Elongation factor Ts EF-Ts tsf BN796_01519 Alistipes sp. CAG:831 Bacteria Bacteroidetes Bacteroidia Bacteroidales Rikenellaceae Alistipes environmental samples NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] MGS:831 Associates with the EF-Tu.GDP complex and induces the exchange of GDP to GTP. It remains bound to the aminoacyl-tRNA.EF-Tu.GTP complex up to the GTP hydrolysis stage on the ribosome. Cytoplasm Belongs to the EF-Ts family. The sequence shown here is derived from an EMBL/GenBank/DDBJ whole genome shotgun (WGS) entry which is preliminary data. Complete proteome Cytoplasm Elongation factor Protein biosynthesis Reference proteome MEIKAIDVQKLRKMTGAGMMDCKKALIEANGDYERAKEIIREKGKLVAAKRADRETSEGA VVAKVDGSKGILLCLGCETDFVAKNEEFQALANAIADAAIKALPADMEALKACTIADGRT VEAAITEQIGKTGEKHSLVAYEKVEAPYIISYIHTINGKLGAIVGFNKEVPVDLAKGVAM QVASMNPVAVNKEAVPQNVIDEELKVAVEKTKEELVKKAVDAALSKAGINPAHVDSEDHI QSNTAKGWLTPEQADQAREIIRTVSAEKAANLQEAMVNNIANGRLNKFFKENTLEEQEYQ MGDGKTSVKAAIAAVDKDAKVTVFKRISLVD Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms Distributed under the Creative Commons Attribution-NoDerivs License