Q13639 Q96KH9 Q96KI0 Q9H199 Q9NY73 Q9UBM6 Q9UBT4 Q9UE22 Q9UE23 Q9UQR6 5HT4R_HUMAN 5-hydroxytryptamine receptor 4 5-HT-4 5-HT4 Serotonin receptor 4 HTR4 Homo sapiens Human Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Cloning, expression, and pharmacology of four human 5-hydroxytryptamine 4 receptor isoforms produced by alternative splicing in the carboxyl terminus. NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5-HT4(A); 5-HT4(B); 5-HT4(C) AND 5-HT4(D)) Gut Cloning and expression of 5-HT4 receptor species and splice variants. NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5-HT4(A) AND 5-HT4(B)) Brain Cloning and expression of human 5-HT4S receptors. Effect of receptor density on their coupling to adenylyl cyclase. NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5-HT4(A)) Heart Novel brain-specific 5-HT4 receptor splice variants show marked constitutive activity: role of the C-terminal intracellular domain. NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5-HT4(E)) Brain Cloning and characterization of multiple human 5-HT4 receptor variants including a novel variant that lacks the alternatively spliced C-terminal exon. NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5-HT4(A); 5-HT4(E) AND 5-HT4(G)) Hippocampus The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5-HT4(B)) Structure of the human serotonin 5-HT4 receptor gene and cloning of a novel 5-HT4 splice variant. NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 10-388 (ISOFORM 5-HT4(F)) Expression of serotonin receptor mRNAs in blood vessels. NUCLEOTIDE SEQUENCE [MRNA] OF 112-255 Brain This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase. Isoform 5-HT4(A) interacts with MAGI2, MPP3, SLC9A3R1 and SNX27 isoforms 1 and 2. Isoform 5-HT4(E) interacts with INADL, NOS1 and SEC23A. Isoform 5-HT4(A) forms a complex including SLC9A3R1 and EZR (By similarity). Cell membrane Multi-pass membrane protein Endosome Interaction with SNX27 mediates recruitment to early endosomes, while interaction with SLC9A3R1 and EZR might target the protein to specialized subcellular regions, such as microvilli (By similarity). Q13639-1 5-HT4(B) Q13639-2 5-HT4(A) 5-HT4S Q13639-3 5-HT4(C) Q13639-4 5-HT4(D) Q13639-5 5-HT4(E) H5-HT4(g) Q13639-6 5-HT4(F) Q13639-7 5-HT4(G) Additional isoforms seem to exist. Isoform 5-HT4(A) is expressed in ileum, brain, and atrium, but not in the ventricle. Belongs to the G-protein coupled receptor 1 family. Alternative splicing Cell membrane Complete proteome Disulfide bond Endosome G-protein coupled receptor Glycoprotein Lipoprotein Membrane Palmitate Polymorphism Receptor Transducer Transmembrane L LERSLNQGLGQDFHA RDAVECGGQWESQCHPPATSPLVAAQPSDT SSGTETDRRNFGIRKRRLTKPS RDAVECGGQWESQCHPPATSPLVAAQPSDT SGCSPVSSFLLLFCNRPVPV DAVECGGQWESQCHPPATSPLVAAQPSDT YTVLHRGHHQELEKLPIHNDPESLESCF DAVECGGQWESQCHPPATSPLVAAQPSDT F C Y MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIV SLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYY AICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSN STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRP QSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWL GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD AVECGGQWESQCHPPATSPLVAAQPSDT Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms Distributed under the Creative Commons Attribution-NoDerivs License