<?xml version="1.0"?>
<BlastXML2
    xmlns="http://www.ncbi.nlm.nih.gov"
    xmlns:xs="http://www.w3.org/2001/XMLSchema-instance"
    xs:schemaLocation="http://www.ncbi.nlm.nih.gov http://www.ncbi.nlm.nih.gov/data_specs/schema_alt/NCBI_BlastOutput2.xsd"
>
<BlastOutput2>
  <report>
    <Report>
      <program>tblastx</program>
      <version>TBLASTX 2.9.0+</version>
      <reference>Stephen F. Altschul, Thomas L. Madden, Alejandro A. Sch&amp;auml;ffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), &quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search programs&quot;, Nucleic Acids Res. 25:3389-3402.</reference>
      <search-target>
        <Target>
          <db>nr</db>
        </Target>
      </search-target>
      <params>
        <Parameters>
          <matrix>BLOSUM62</matrix>
          <expect>10</expect>
          <filter>F</filter>
          <query-gencode>1</query-gencode>
          <db-gencode>1</db-gencode>
        </Parameters>
      </params>
      <results>
        <Results>
          <search>
            <Search>
              <query-id>AI021773.1</query-id>
              <query-title>MAAD0534.RAR Schistosoma mansoni, adult worm (J.C.Parra) Schistosoma mansoni cDNA clone MAAD0534.RAR 5&apos; end similar to S. mansoni actin mRNA, complete cds, mRNA sequence</query-title>
              <query-len>365</query-len>
              <hits>
                <Hit>
                  <num>1</num>
                  <description>
                    <HitDescr>
                      <id>gi|1580143357|ref|XM_012666578.2|</id>
                      <accession>XM_012666578</accession>
                      <title>PREDICTED: Monomorium pharaonis actin-5C (LOC105828314), transcript variant X1, mRNA</title>
                      <taxid>307658</taxid>
                      <sciname>Monomorium pharaonis</sciname>
                    </HitDescr>
                  </description>
                  <len>2403</len>
                  <hsps>
                    <Hsp>
                      <num>1</num>
                      <bit-score>151.818</bit-score>
                      <score>325</score>
                      <evalue>7.79607e-61</evalue>
                      <identity>59</identity>
                      <positive>59</positive>
                      <query-from>164</query-from>
                      <query-to>343</query-to>
                      <query-frame>2</query-frame>
                      <hit-from>352</hit-from>
                      <hit-to>531</hit-to>
                      <hit-frame>1</hit-frame>
                      <align-len>60</align-len>
                      <gaps>0</gaps>
                      <qseq>GSKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE</qseq>
                      <hseq>GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE</hseq>
                      <midline>G KDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE</midline>
                    </Hsp>
                    <Hsp>
                      <num>2</num>
                      <bit-score>82.6285</bit-score>
                      <score>174</score>
                      <evalue>7.79607e-61</evalue>
                      <identity>33</identity>
                      <positive>33</positive>
                      <query-from>66</query-from>
                      <query-to>173</query-to>
                      <query-frame>3</query-frame>
                      <hit-from>253</hit-from>
                      <hit-to>360</hit-to>
                      <hit-frame>1</hit-frame>
                      <align-len>36</align-len>
                      <gaps>0</gaps>
                      <qseq>GCAKLGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK</qseq>
                      <hseq>GMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK</hseq>
                      <midline>G  K GFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK</midline>
                    </Hsp>
                    <Hsp>
                      <num>3</num>
                      <bit-score>47.3464</bit-score>
                      <score>97</score>
                      <evalue>7.79607e-61</evalue>
                      <identity>19</identity>
                      <positive>19</positive>
                      <query-from>20</query-from>
                      <query-to>82</query-to>
                      <query-frame>2</query-frame>
                      <hit-from>208</hit-from>
                      <hit-to>270</hit-to>
                      <hit-frame>1</hit-frame>
                      <align-len>21</align-len>
                      <gaps>0</gaps>
                      <qseq>MADEEVQALVVDNGSGMCKAG</qseq>
                      <hseq>MCDEEVAALVVDNGSGMCKAG</hseq>
                      <midline>M DEEV ALVVDNGSGMCKAG</midline>
                    </Hsp>
                    <Hsp>
                      <num>4</num>
                      <bit-score>111.037</bit-score>
                      <score>236</score>
                      <evalue>8.2679e-39</evalue>
                      <identity>50</identity>
                      <positive>53</positive>
                      <query-from>163</query-from>
                      <query-to>345</query-to>
                      <query-frame>-3</query-frame>
                      <hit-from>351</hit-from>
                      <hit-to>533</hit-to>
                      <hit-frame>-2</hit-frame>
                      <align-len>61</align-len>
                      <gaps>0</gaps>
                      <qseq>SSVNRTGCSSGATRNSL*NV*CQIFSMSSQFVTIPCSIGYFSVRIPRFDCASSPT*LSFDP</qseq>
                      <hseq>ASVRRTGCSSGATRSSL*NV*CQIFSMSSQLVTIPCSIGYLSVRMPLLD*ASSPT*ESFCP</hseq>
                      <midline>+SV RTGCSSGATR+SL*NV*CQIFSMSSQ VTIPCSIGY SVR+P  D ASSPT* SF P</midline>
                    </Hsp>
                    <Hsp>
                      <num>5</num>
                      <bit-score>52.8449</bit-score>
                      <score>109</score>
                      <evalue>8.2679e-39</evalue>
                      <identity>23</identity>
                      <positive>26</positive>
                      <query-from>65</query-from>
                      <query-to>172</query-to>
                      <query-frame>-2</query-frame>
                      <hit-from>252</hit-from>
                      <hit-to>359</hit-to>
                      <hit-frame>-2</hit-frame>
                      <align-len>36</align-len>
                      <gaps>0</gaps>
                      <qseq>F*PIPTITP*CRGRPTMEGNTALGASSPANPSFAHP</qseq>
                      <hseq>FCPIPTMTPW*RGLPTIEGKTARGASSPAKPALHIP</hseq>
                      <midline>F PIPT+TP  RG PT+EG TA GASSPA P+   P</midline>
                    </Hsp>
                    <Hsp>
                      <num>6</num>
                      <bit-score>43.6807</bit-score>
                      <score>89</score>
                      <evalue>8.2679e-39</evalue>
                      <identity>19</identity>
                      <positive>19</positive>
                      <query-from>10</query-from>
                      <query-to>81</query-to>
                      <query-frame>-3</query-frame>
                      <hit-from>198</hit-from>
                      <hit-to>269</hit-to>
                      <hit-frame>-2</hit-frame>
                      <align-len>24</align-len>
                      <gaps>0</gaps>
                      <qseq>PALHIPDPLSTTRA*TSSSAMIIF</qseq>
                      <hseq>PALHIPDPLSTTSAATSSSHMFAF</hseq>
                      <midline>PALHIPDPLSTT A TSSS M  F</midline>
                    </Hsp>
                    <Hsp>
                      <num>7</num>
                      <bit-score>85.3777</bit-score>
                      <score>180</score>
                      <evalue>1.20724e-16</evalue>
                      <identity>31</identity>
                      <positive>44</positive>
                      <query-from>170</query-from>
                      <query-to>337</query-to>
                      <query-frame>-2</query-frame>
                      <hit-from>358</hit-from>
                      <hit-to>525</hit-to>
                      <hit-frame>-1</hit-frame>
                      <align-len>56</align-len>
                      <gaps>0</gaps>
                      <qseq>QQDRVFFWSHTQFIVECVMPDLLHVIPVRHNTVFDWVFQCENTTFRLCFITDVAVF</qseq>
                      <hseq>EKDRMFLWSYSQLIVERVMPDLLHVVPVGNNTVFNWIFER*NASLGLSLVTDVRIF</hseq>
                      <midline>++DR+F WS++Q IVE VMPDLLHV+PV +NTVF+W+F+  N +  L  +TDV +F</midline>
                    </Hsp>
                    <Hsp>
                      <num>8</num>
                      <bit-score>29.4763</bit-score>
                      <score>58</score>
                      <evalue>1.20724e-16</evalue>
                      <identity>11</identity>
                      <positive>22</positive>
                      <query-from>75</query-from>
                      <query-to>170</query-to>
                      <query-frame>-1</query-frame>
                      <hit-from>262</hit-from>
                      <hit-to>357</hit-to>
                      <hit-frame>-1</hit-frame>
                      <align-len>32</align-len>
                      <gaps>0</gaps>
                      <qseq>LTHTNHHTLMSRSSNDGREYCSWCIITSESQL</qseq>
                      <hseq>LSHTNHDTLVTWPADD*RKDSTRSVVSGEASL</hseq>
                      <midline>L+HTNH TL++  ++D R+  +  +++ E+ L</midline>
                    </Hsp>
                    <Hsp>
                      <num>9</num>
                      <bit-score>67.0494</bit-score>
                      <score>140</score>
                      <evalue>2.02356e-10</evalue>
                      <identity>31</identity>
                      <positive>39</positive>
                      <query-from>169</query-from>
                      <query-to>333</query-to>
                      <query-frame>1</query-frame>
                      <hit-from>357</hit-from>
                      <hit-to>521</hit-to>
                      <hit-frame>3</hit-frame>
                      <align-len>55</align-len>
                      <gaps>0</gaps>
                      <qseq>KRQLRR**STIETWYSHTEIPNRTRYCDELG*HGEDLASHILQ*IACGSRRTPCP</qseq>
                      <hseq>KRFLRR*RGSVQERHSNAQISN*TRYCYQLGRHGEDLASHVLQ*AASSSRGTSGP</hseq>
                      <midline>KR LRR*  +++  +S+ +I N TRYC +LG HGEDLASH+LQ* A  SR T  P</midline>
                    </Hsp>
                    <Hsp>
                      <num>10</num>
                      <bit-score>26.727</bit-score>
                      <score>52</score>
                      <evalue>2.02356e-10</evalue>
                      <identity>8</identity>
                      <positive>13</positive>
                      <query-from>113</query-from>
                      <query-to>172</query-to>
                      <query-frame>2</query-frame>
                      <hit-from>300</hit-from>
                      <hit-to>359</hit-to>
                      <hit-frame>3</hit-frame>
                      <align-len>20</align-len>
                      <gaps>0</gaps>
                      <qseq>IPFHRWTTSTSRCDGWYGSK</qseq>
                      <hseq>LSFNRRQATSPGCHGWYGTK</hseq>
                      <midline>+ F+R   ++  C GWYG+K</midline>
                    </Hsp>
                    <Hsp>
                      <num>11</num>
                      <bit-score>58.8016</bit-score>
                      <score>122</score>
                      <evalue>1.4978e-05</evalue>
                      <identity>29</identity>
                      <positive>34</positive>
                      <query-from>168</query-from>
                      <query-to>332</query-to>
                      <query-frame>3</query-frame>
                      <hit-from>356</hit-from>
                      <hit-to>520</hit-to>
                      <hit-frame>2</hit-frame>
                      <align-len>55</align-len>
                      <gaps>0</gaps>
                      <qseq>QKTATSVMKHNRNVVFSH*NTQSNTVL*RTGMTWRRSGITHSTMNCVWLQKNTLS</qseq>
                      <hseq>KKILTSVTRLSPREAF*RSNIQLNTVLLPTGTTWRRSGITRSTMSCE*LQRNIRS</hseq>
                      <midline>+K  TSV + +    F   N Q NTVL  TG TWRRSGIT STM+C  LQ+N  S</midline>
                    </Hsp>
                    <Hsp>
                      <num>12</num>
                      <bit-score>54.6777</bit-score>
                      <score>113</score>
                      <evalue>0.000261134</evalue>
                      <identity>24</identity>
                      <positive>25</positive>
                      <query-from>225</query-from>
                      <query-to>332</query-to>
                      <query-frame>-1</query-frame>
                      <hit-from>413</hit-from>
                      <hit-to>520</hit-to>
                      <hit-frame>-3</hit-frame>
                      <align-len>36</align-len>
                      <gaps>0</gaps>
                      <qseq>GQGVLLEPHAIHCRMCDARSSPCHPSSSQYRVRLGI</qseq>
                      <hseq>GPDVPLELLAAHCRTCDARSSPCRPSW*QYRVQLDI</hseq>
                      <midline>G  V LE  A HCR CDARSSPC PS  QYRV+L I</midline>
                    </Hsp>
                  </hsps>
                </Hit>
                <Hit>
                  <num>2</num>
                  <description>
                    <HitDescr>
                      <id>gi|1580143358|ref|XM_012666577.2|</id>
                      <accession>XM_012666577</accession>
                      <title>PREDICTED: Monomorium pharaonis actin-5C (LOC105828314), transcript variant X2, mRNA</title>
                      <taxid>307658</taxid>
                      <sciname>Monomorium pharaonis</sciname>
                    </HitDescr>
                  </description>
                  <len>2364</len>
                  <hsps>
                    <Hsp>
                      <num>1</num>
                      <bit-score>151.818</bit-score>
                      <score>325</score>
                      <evalue>7.79763e-61</evalue>
                      <identity>59</identity>
                      <positive>59</positive>
                      <query-from>164</query-from>
                      <query-to>343</query-to>
                      <query-frame>2</query-frame>
                      <hit-from>313</hit-from>
                      <hit-to>492</hit-to>
                      <hit-frame>1</hit-frame>
                      <align-len>60</align-len>
                      <gaps>0</gaps>
                      <qseq>GSKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE</qseq>
                      <hseq>GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE</hseq>
                      <midline>G KDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE</midline>
                    </Hsp>
                    <Hsp>
                      <num>2</num>
                      <bit-score>82.6285</bit-score>
                      <score>174</score>
                      <evalue>7.79763e-61</evalue>
                      <identity>33</identity>
                      <positive>33</positive>
                      <query-from>66</query-from>
                      <query-to>173</query-to>
                      <query-frame>3</query-frame>
                      <hit-from>214</hit-from>
                      <hit-to>321</hit-to>
                      <hit-frame>1</hit-frame>
                      <align-len>36</align-len>
                      <gaps>0</gaps>
                      <qseq>GCAKLGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK</qseq>
                      <hseq>GMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK</hseq>
                      <midline>G  K GFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK</midline>
                    </Hsp>
                    <Hsp>
                      <num>3</num>
                      <bit-score>47.3464</bit-score>
                      <score>97</score>
                      <evalue>7.79763e-61</evalue>
                      <identity>19</identity>
                      <positive>19</positive>
                      <query-from>20</query-from>
                      <query-to>82</query-to>
                      <query-frame>2</query-frame>
                      <hit-from>169</hit-from>
                      <hit-to>231</hit-to>
                      <hit-frame>1</hit-frame>
                      <align-len>21</align-len>
                      <gaps>0</gaps>
                      <qseq>MADEEVQALVVDNGSGMCKAG</qseq>
                      <hseq>MCDEEVAALVVDNGSGMCKAG</hseq>
                      <midline>M DEEV ALVVDNGSGMCKAG</midline>
                    </Hsp>
                    <Hsp>
                      <num>4</num>
                      <bit-score>111.037</bit-score>
                      <score>236</score>
                      <evalue>8.2703e-39</evalue>
                      <identity>50</identity>
                      <positive>53</positive>
                      <query-from>163</query-from>
                      <query-to>345</query-to>
                      <query-frame>-3</query-frame>
                      <hit-from>312</hit-from>
                      <hit-to>494</hit-to>
                      <hit-frame>-2</hit-frame>
                      <align-len>61</align-len>
                      <gaps>0</gaps>
                      <qseq>SSVNRTGCSSGATRNSL*NV*CQIFSMSSQFVTIPCSIGYFSVRIPRFDCASSPT*LSFDP</qseq>
                      <hseq>ASVRRTGCSSGATRSSL*NV*CQIFSMSSQLVTIPCSIGYLSVRMPLLD*ASSPT*ESFCP</hseq>
                      <midline>+SV RTGCSSGATR+SL*NV*CQIFSMSSQ VTIPCSIGY SVR+P  D ASSPT* SF P</midline>
                    </Hsp>
                    <Hsp>
                      <num>5</num>
                      <bit-score>52.8449</bit-score>
                      <score>109</score>
                      <evalue>8.2703e-39</evalue>
                      <identity>23</identity>
                      <positive>26</positive>
                      <query-from>65</query-from>
                      <query-to>172</query-to>
                      <query-frame>-2</query-frame>
                      <hit-from>213</hit-from>
                      <hit-to>320</hit-to>
                      <hit-frame>-2</hit-frame>
                      <align-len>36</align-len>
                      <gaps>0</gaps>
                      <qseq>F*PIPTITP*CRGRPTMEGNTALGASSPANPSFAHP</qseq>
                      <hseq>FCPIPTMTPW*RGLPTIEGKTARGASSPAKPALHIP</hseq>
                      <midline>F PIPT+TP  RG PT+EG TA GASSPA P+   P</midline>
                    </Hsp>
                    <Hsp>
                      <num>6</num>
                      <bit-score>43.6807</bit-score>
                      <score>89</score>
                      <evalue>8.2703e-39</evalue>
                      <identity>19</identity>
                      <positive>19</positive>
                      <query-from>10</query-from>
                      <query-to>81</query-to>
                      <query-frame>-3</query-frame>
                      <hit-from>159</hit-from>
                      <hit-to>230</hit-to>
                      <hit-frame>-2</hit-frame>
                      <align-len>24</align-len>
                      <gaps>0</gaps>
                      <qseq>PALHIPDPLSTTRA*TSSSAMIIF</qseq>
                      <hseq>PALHIPDPLSTTSAATSSSHMFAF</hseq>
                      <midline>PALHIPDPLSTT A TSSS M  F</midline>
                    </Hsp>
                    <Hsp>
                      <num>7</num>
                      <bit-score>85.3777</bit-score>
                      <score>180</score>
                      <evalue>1.20758e-16</evalue>
                      <identity>31</identity>
                      <positive>44</positive>
                      <query-from>170</query-from>
                      <query-to>337</query-to>
                      <query-frame>-2</query-frame>
                      <hit-from>319</hit-from>
                      <hit-to>486</hit-to>
                      <hit-frame>-1</hit-frame>
                      <align-len>56</align-len>
                      <gaps>0</gaps>
                      <qseq>QQDRVFFWSHTQFIVECVMPDLLHVIPVRHNTVFDWVFQCENTTFRLCFITDVAVF</qseq>
                      <hseq>EKDRMFLWSYSQLIVERVMPDLLHVVPVGNNTVFNWIFER*NASLGLSLVTDVRIF</hseq>
                      <midline>++DR+F WS++Q IVE VMPDLLHV+PV +NTVF+W+F+  N +  L  +TDV +F</midline>
                    </Hsp>
                    <Hsp>
                      <num>8</num>
                      <bit-score>29.4763</bit-score>
                      <score>58</score>
                      <evalue>1.20758e-16</evalue>
                      <identity>11</identity>
                      <positive>22</positive>
                      <query-from>75</query-from>
                      <query-to>170</query-to>
                      <query-frame>-1</query-frame>
                      <hit-from>223</hit-from>
                      <hit-to>318</hit-to>
                      <hit-frame>-1</hit-frame>
                      <align-len>32</align-len>
                      <gaps>0</gaps>
                      <qseq>LTHTNHHTLMSRSSNDGREYCSWCIITSESQL</qseq>
                      <hseq>LSHTNHDTLVTWPADD*RKDSTRSVVSGEASL</hseq>
                      <midline>L+HTNH TL++  ++D R+  +  +++ E+ L</midline>
                    </Hsp>
                    <Hsp>
                      <num>9</num>
                      <bit-score>67.0494</bit-score>
                      <score>140</score>
                      <evalue>2.0243e-10</evalue>
                      <identity>31</identity>
                      <positive>39</positive>
                      <query-from>169</query-from>
                      <query-to>333</query-to>
                      <query-frame>1</query-frame>
                      <hit-from>318</hit-from>
                      <hit-to>482</hit-to>
                      <hit-frame>3</hit-frame>
                      <align-len>55</align-len>
                      <gaps>0</gaps>
                      <qseq>KRQLRR**STIETWYSHTEIPNRTRYCDELG*HGEDLASHILQ*IACGSRRTPCP</qseq>
                      <hseq>KRFLRR*RGSVQERHSNAQISN*TRYCYQLGRHGEDLASHVLQ*AASSSRGTSGP</hseq>
                      <midline>KR LRR*  +++  +S+ +I N TRYC +LG HGEDLASH+LQ* A  SR T  P</midline>
                    </Hsp>
                    <Hsp>
                      <num>10</num>
                      <bit-score>26.727</bit-score>
                      <score>52</score>
                      <evalue>2.0243e-10</evalue>
                      <identity>8</identity>
                      <positive>13</positive>
                      <query-from>113</query-from>
                      <query-to>172</query-to>
                      <query-frame>2</query-frame>
                      <hit-from>261</hit-from>
                      <hit-to>320</hit-to>
                      <hit-frame>3</hit-frame>
                      <align-len>20</align-len>
                      <gaps>0</gaps>
                      <qseq>IPFHRWTTSTSRCDGWYGSK</qseq>
                      <hseq>LSFNRRQATSPGCHGWYGTK</hseq>
                      <midline>+ F+R   ++  C GWYG+K</midline>
                    </Hsp>
                    <Hsp>
                      <num>11</num>
                      <bit-score>58.8016</bit-score>
                      <score>122</score>
                      <evalue>1.4978e-05</evalue>
                      <identity>29</identity>
                      <positive>34</positive>
                      <query-from>168</query-from>
                      <query-to>332</query-to>
                      <query-frame>3</query-frame>
                      <hit-from>317</hit-from>
                      <hit-to>481</hit-to>
                      <hit-frame>2</hit-frame>
                      <align-len>55</align-len>
                      <gaps>0</gaps>
                      <qseq>QKTATSVMKHNRNVVFSH*NTQSNTVL*RTGMTWRRSGITHSTMNCVWLQKNTLS</qseq>
                      <hseq>KKILTSVTRLSPREAF*RSNIQLNTVLLPTGTTWRRSGITRSTMSCE*LQRNIRS</hseq>
                      <midline>+K  TSV + +    F   N Q NTVL  TG TWRRSGIT STM+C  LQ+N  S</midline>
                    </Hsp>
                    <Hsp>
                      <num>12</num>
                      <bit-score>54.6777</bit-score>
                      <score>113</score>
                      <evalue>0.000261134</evalue>
                      <identity>24</identity>
                      <positive>25</positive>
                      <query-from>225</query-from>
                      <query-to>332</query-to>
                      <query-frame>-1</query-frame>
                      <hit-from>374</hit-from>
                      <hit-to>481</hit-to>
                      <hit-frame>-3</hit-frame>
                      <align-len>36</align-len>
                      <gaps>0</gaps>
                      <qseq>GQGVLLEPHAIHCRMCDARSSPCHPSSSQYRVRLGI</qseq>
                      <hseq>GPDVPLELLAAHCRTCDARSSPCRPSW*QYRVQLDI</hseq>
                      <midline>G  V LE  A HCR CDARSSPC PS  QYRV+L I</midline>
                    </Hsp>
                  </hsps>
                </Hit>
                <Hit>
                  <num>3</num>
                  <description>
                    <HitDescr>
                      <id>gi|1590279040|ref|XM_028307359.1|</id>
                      <accession>XM_028307359</accession>
                      <title>PREDICTED: Ostrinia furnacalis actin-5C (LOC114354797), transcript variant X2, mRNA</title>
                      <taxid>93504</taxid>
                      <sciname>Ostrinia furnacalis</sciname>
                    </HitDescr>
                  </description>
                  <len>1791</len>
                  <hsps>
                    <Hsp>
                      <num>1</num>
                      <bit-score>151.818</bit-score>
                      <score>325</score>
                      <evalue>7.82427e-61</evalue>
                      <identity>59</identity>
                      <positive>59</positive>
                      <query-from>164</query-from>
                      <query-to>343</query-to>
                      <query-frame>2</query-frame>
                      <hit-from>492</hit-from>
                      <hit-to>671</hit-to>
                      <hit-frame>3</hit-frame>
                      <align-len>60</align-len>
                      <gaps>0</gaps>
                      <qseq>GSKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE</qseq>
                      <hseq>GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE</hseq>
                      <midline>G KDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE</midline>
                    </Hsp>
                    <Hsp>
                      <num>2</num>
                      <bit-score>82.6285</bit-score>
                      <score>174</score>
                      <evalue>7.82427e-61</evalue>
                      <identity>33</identity>
                      <positive>33</positive>
                      <query-from>66</query-from>
                      <query-to>173</query-to>
                      <query-frame>3</query-frame>
                      <hit-from>393</hit-from>
                      <hit-to>500</hit-to>
                      <hit-frame>3</hit-frame>
                      <align-len>36</align-len>
                      <gaps>0</gaps>
                      <qseq>GCAKLGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK</qseq>
                      <hseq>GMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK</hseq>
                      <midline>G  K GFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK</midline>
                    </Hsp>
                    <Hsp>
                      <num>3</num>
                      <bit-score>47.3464</bit-score>
                      <score>97</score>
                      <evalue>7.82427e-61</evalue>
                      <identity>19</identity>
                      <positive>19</positive>
                      <query-from>20</query-from>
                      <query-to>82</query-to>
                      <query-frame>2</query-frame>
                      <hit-from>348</hit-from>
                      <hit-to>410</hit-to>
                      <hit-frame>3</hit-frame>
                      <align-len>21</align-len>
                      <gaps>0</gaps>
                      <qseq>MADEEVQALVVDNGSGMCKAG</qseq>
                      <hseq>MCDEEVAALVVDNGSGMCKAG</hseq>
                      <midline>M DEEV ALVVDNGSGMCKAG</midline>
                    </Hsp>
                    <Hsp>
                      <num>4</num>
                      <bit-score>103.706</bit-score>
                      <score>220</score>
                      <evalue>4.80057e-37</evalue>
                      <identity>47</identity>
                      <positive>52</positive>
                      <query-from>163</query-from>
                      <query-to>354</query-to>
                      <query-frame>-3</query-frame>
                      <hit-from>491</hit-from>
                      <hit-to>682</hit-to>
                      <hit-frame>-3</hit-frame>
                      <align-len>64</align-len>
                      <gaps>0</gaps>
                      <qseq>IQWSSVNRTGCSSGATRNSL*NV*CQIFSMSSQFVTIPCSIGYFSVRIPRFDCASSPT*LSFDP</qseq>
                      <hseq>LRGASVRRTGCSSGATRSSL*KVWCQIFSMSSQFVTIPCSMGYFRVRIPLLLWASSPTYESFCP</hseq>
                      <midline>++ +SV RTGCSSGATR+SL* V CQIFSMSSQFVTIPCS+GYF VRIP    ASSPT  SF P</midline>
                    </Hsp>
                    <Hsp>
                      <num>5</num>
                      <bit-score>58.3434</bit-score>
                      <score>121</score>
                      <evalue>4.80057e-37</evalue>
                      <identity>24</identity>
                      <positive>28</positive>
                      <query-from>65</query-from>
                      <query-to>172</query-to>
                      <query-frame>-2</query-frame>
                      <hit-from>392</hit-from>
                      <hit-to>499</hit-to>
                      <hit-frame>-3</hit-frame>
                      <align-len>36</align-len>
                      <gaps>0</gaps>
                      <qseq>F*PIPTITP*CRGRPTMEGNTALGASSPANPSFAHP</qseq>
                      <hseq>FCPMPTITPWWRGRPTIDGNTARGASSPAKPALHIP</hseq>
                      <midline>F P+PTITP  RGRPT++GNTA GASSPA P+   P</midline>
                    </Hsp>
                    <Hsp>
                      <num>6</num>
                      <bit-score>39.5569</bit-score>
                      <score>80</score>
                      <evalue>4.80057e-37</evalue>
                      <identity>16</identity>
                      <positive>19</positive>
                      <query-from>16</query-from>
                      <query-to>81</query-to>
                      <query-frame>-3</query-frame>
                      <hit-from>344</hit-from>
                      <hit-to>409</hit-to>
                      <hit-frame>-3</hit-frame>
                      <align-len>22</align-len>
                      <gaps>0</gaps>
                      <qseq>PALHIPDPLSTTRA*TSSSAMI</qseq>
                      <hseq>PALHIPEPLSTTNAATSSSHIV</hseq>
                      <midline>PALHIP+PLSTT A TSSS ++</midline>
                    </Hsp>
                    <Hsp>
                      <num>7</num>
                      <bit-score>74.8389</bit-score>
                      <score>157</score>
                      <evalue>4.23146e-16</evalue>
                      <identity>33</identity>
                      <positive>42</positive>
                      <query-from>173</query-from>
                      <query-to>343</query-to>
                      <query-frame>-2</query-frame>
                      <hit-from>501</hit-from>
                      <hit-to>671</hit-to>
                      <hit-frame>-2</hit-frame>
                      <align-len>57</align-len>
                      <gaps>0</gaps>
                      <qseq>LGQQDRVFFWSHTQFIVECVMPDLLHVIPVRHNTVFDWVFQCENTTFRLCFITDVAV</qseq>
                      <hseq>LCEKDWVFLGGDTEFIVEGVVPDLLHVIPVRDDSVFDGVFQSEDTSLALGLVTDVRV</hseq>
                      <midline>L ++D VF    T+FIVE V+PDLLHVIPVR ++VFD VFQ E+T+  L  +TDV V</midline>
                    </Hsp>
                    <Hsp>
                      <num>8</num>
                      <bit-score>38.1822</bit-score>
                      <score>77</score>
                      <evalue>4.23146e-16</evalue>
                      <identity>14</identity>
                      <positive>25</positive>
                      <query-from>75</query-from>
                      <query-to>173</query-to>
                      <query-frame>-1</query-frame>
                      <hit-from>402</hit-from>
                      <hit-to>500</hit-to>
                      <hit-frame>-2</hit-frame>
                      <align-len>33</align-len>
                      <gaps>0</gaps>
                      <qseq>LLTHTNHHTLMSRSSNDGREYCSWCIITSESQL</qseq>
                      <hseq>LLSHANHHTLVARAAHDRWEHGAGRVVTRETGL</hseq>
                      <midline>LL+H NHHTL++R+++D  E+ +  ++T E+ L</midline>
                    </Hsp>
                    <Hsp>
                      <num>9</num>
                      <bit-score>67.0494</bit-score>
                      <score>140</score>
                      <evalue>2.03695e-10</evalue>
                      <identity>32</identity>
                      <positive>37</positive>
                      <query-from>178</query-from>
                      <query-to>357</query-to>
                      <query-frame>1</query-frame>
                      <hit-from>506</hit-from>
                      <hit-to>685</hit-to>
                      <hit-frame>2</hit-frame>
                      <align-len>60</align-len>
                      <gaps>0</gaps>
                      <qseq>LRR**STIETWYSHTEIPNRTRYCDELG*HGEDLASHILQ*IACGSRRTPCPVDRAPLYP</qseq>
                      <hseq>VRR*RGPEQERYPHSEIPHRTRNRHELG*HGEDLAPHLLQ*TPCRPRGTPSPSHRGTPQP</hseq>
                      <midline>+RR*    +  Y H+EIP+RTR   ELG*HGEDLA H+LQ*  C  R TP P  R    P</midline>
                    </Hsp>
                    <Hsp>
                      <num>10</num>
                      <bit-score>26.727</bit-score>
                      <score>52</score>
                      <evalue>2.03695e-10</evalue>
                      <identity>8</identity>
                      <positive>12</positive>
                      <query-from>113</query-from>
                      <query-to>172</query-to>
                      <query-frame>2</query-frame>
                      <hit-from>440</hit-from>
                      <hit-to>499</hit-to>
                      <hit-frame>2</hit-frame>
                      <align-len>20</align-len>
                      <gaps>0</gaps>
                      <qseq>IPFHRWTTSTSRCDGWYGSK</qseq>
                      <hseq>VPIDRGPPSPPGCDGWHGTE</hseq>
                      <midline>+P  R   S   CDGW+G++</midline>
                    </Hsp>
                    <Hsp>
                      <num>11</num>
                      <bit-score>65.2165</bit-score>
                      <score>136</score>
                      <evalue>1.75538e-07</evalue>
                      <identity>29</identity>
                      <positive>33</positive>
                      <query-from>177</query-from>
                      <query-to>332</query-to>
                      <query-frame>-1</query-frame>
                      <hit-from>505</hit-from>
                      <hit-to>660</hit-to>
                      <hit-frame>-1</hit-frame>
                      <align-len>52</align-len>
                      <gaps>0</gaps>
                      <qseq>GQGVLLEPHAIHCRMCDARSSPCHPSSSQYRVRLGISV*EYHVSIVLHHRRS</qseq>
                      <hseq>GLGVPRGRHGVHCRRCGARSSPCHPSS*RFRVRWGISE*GYLSCSGPRHRRT</hseq>
                      <midline>G GV    H +HCR C ARSSPCHPSS ++RVR GIS * Y       HRR+</midline>
                    </Hsp>
                    <Hsp>
                      <num>12</num>
                      <bit-score>61.0927</bit-score>
                      <score>127</score>
                      <evalue>3.06042e-06</evalue>
                      <identity>31</identity>
                      <positive>35</positive>
                      <query-from>168</query-from>
                      <query-to>332</query-to>
                      <query-frame>3</query-frame>
                      <hit-from>496</hit-from>
                      <hit-to>660</hit-to>
                      <hit-frame>1</hit-frame>
                      <align-len>55</align-len>
                      <gaps>0</gaps>
                      <qseq>QKTATSVMKHNRNVVFSH*NTQSNTVL*RTGMTWRRSGITHSTMNCVWLQKNTLS</qseq>
                      <hseq>RRTRTSVTRPRAREVSSL*NTPSNTESSRTGMTWRRSGTTPSTMNSVSPPRNTQS</hseq>
                      <midline>++T TSV +     V S *NT SNT   RTGMTWRRSG T STMN V   +NT S</midline>
                    </Hsp>
                  </hsps>
                </Hit>
                <Hit>
                  <num>4</num>
                  <description>
                    <HitDescr>
                      <id>gi|1590279038|ref|XM_028307358.1|</id>
                      <accession>XM_028307358</accession>
                      <title>PREDICTED: Ostrinia furnacalis actin-5C (LOC114354797), transcript variant X1, mRNA</title>
                      <taxid>93504</taxid>
                      <sciname>Ostrinia furnacalis</sciname>
                    </HitDescr>
                  </description>
                  <len>1677</len>
                  <hsps>
                    <Hsp>
                      <num>1</num>
                      <bit-score>151.818</bit-score>
                      <score>325</score>
                      <evalue>7.83062e-61</evalue>
                      <identity>59</identity>
                      <positive>59</positive>
                      <query-from>164</query-from>
                      <query-to>343</query-to>
                      <query-frame>2</query-frame>
                      <hit-from>378</hit-from>
                      <hit-to>557</hit-to>
                      <hit-frame>3</hit-frame>
                      <align-len>60</align-len>
                      <gaps>0</gaps>
                      <qseq>GSKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE</qseq>
                      <hseq>GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE</hseq>
                      <midline>G KDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE</midline>
                    </Hsp>
                    <Hsp>
                      <num>2</num>
                      <bit-score>82.6285</bit-score>
                      <score>174</score>
                      <evalue>7.83062e-61</evalue>
                      <identity>33</identity>
                      <positive>33</positive>
                      <query-from>66</query-from>
                      <query-to>173</query-to>
                      <query-frame>3</query-frame>
                      <hit-from>279</hit-from>
                      <hit-to>386</hit-to>
                      <hit-frame>3</hit-frame>
                      <align-len>36</align-len>
                      <gaps>0</gaps>
                      <qseq>GCAKLGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK</qseq>
                      <hseq>GMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK</hseq>
                      <midline>G  K GFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK</midline>
                    </Hsp>
                    <Hsp>
                      <num>3</num>
                      <bit-score>47.3464</bit-score>
                      <score>97</score>
                      <evalue>7.83062e-61</evalue>
                      <identity>19</identity>
                      <positive>19</positive>
                      <query-from>20</query-from>
                      <query-to>82</query-to>
                      <query-frame>2</query-frame>
                      <hit-from>234</hit-from>
                      <hit-to>296</hit-to>
                      <hit-frame>3</hit-frame>
                      <align-len>21</align-len>
                      <gaps>0</gaps>
                      <qseq>MADEEVQALVVDNGSGMCKAG</qseq>
                      <hseq>MCDEEVAALVVDNGSGMCKAG</hseq>
                      <midline>M DEEV ALVVDNGSGMCKAG</midline>
                    </Hsp>
                    <Hsp>
                      <num>4</num>
                      <bit-score>103.706</bit-score>
                      <score>220</score>
                      <evalue>4.8064e-37</evalue>
                      <identity>47</identity>
                      <positive>52</positive>
                      <query-from>163</query-from>
                      <query-to>354</query-to>
                      <query-frame>-3</query-frame>
                      <hit-from>377</hit-from>
                      <hit-to>568</hit-to>
                      <hit-frame>-3</hit-frame>
                      <align-len>64</align-len>
                      <gaps>0</gaps>
                      <qseq>IQWSSVNRTGCSSGATRNSL*NV*CQIFSMSSQFVTIPCSIGYFSVRIPRFDCASSPT*LSFDP</qseq>
                      <hseq>LRGASVRRTGCSSGATRSSL*KVWCQIFSMSSQFVTIPCSMGYFRVRIPLLLWASSPTYESFCP</hseq>
                      <midline>++ +SV RTGCSSGATR+SL* V CQIFSMSSQFVTIPCS+GYF VRIP    ASSPT  SF P</midline>
                    </Hsp>
                    <Hsp>
                      <num>5</num>
                      <bit-score>58.3434</bit-score>
                      <score>121</score>
                      <evalue>4.8064e-37</evalue>
                      <identity>24</identity>
                      <positive>28</positive>
                      <query-from>65</query-from>
                      <query-to>172</query-to>
                      <query-frame>-2</query-frame>
                      <hit-from>278</hit-from>
                      <hit-to>385</hit-to>
                      <hit-frame>-3</hit-frame>
                      <align-len>36</align-len>
                      <gaps>0</gaps>
                      <qseq>F*PIPTITP*CRGRPTMEGNTALGASSPANPSFAHP</qseq>
                      <hseq>FCPMPTITPWWRGRPTIDGNTARGASSPAKPALHIP</hseq>
                      <midline>F P+PTITP  RGRPT++GNTA GASSPA P+   P</midline>
                    </Hsp>
                    <Hsp>
                      <num>6</num>
                      <bit-score>39.5569</bit-score>
                      <score>80</score>
                      <evalue>4.8064e-37</evalue>
                      <identity>16</identity>
                      <positive>19</positive>
                      <query-from>16</query-from>
                      <query-to>81</query-to>
                      <query-frame>-3</query-frame>
                      <hit-from>230</hit-from>
                      <hit-to>295</hit-to>
                      <hit-frame>-3</hit-frame>
                      <align-len>22</align-len>
                      <gaps>0</gaps>
                      <qseq>PALHIPDPLSTTRA*TSSSAMI</qseq>
                      <hseq>PALHIPEPLSTTNAATSSSHIV</hseq>
                      <midline>PALHIP+PLSTT A TSSS ++</midline>
                    </Hsp>
                    <Hsp>
                      <num>7</num>
                      <bit-score>74.8389</bit-score>
                      <score>157</score>
                      <evalue>4.23631e-16</evalue>
                      <identity>33</identity>
                      <positive>42</positive>
                      <query-from>173</query-from>
                      <query-to>343</query-to>
                      <query-frame>-2</query-frame>
                      <hit-from>387</hit-from>
                      <hit-to>557</hit-to>
                      <hit-frame>-2</hit-frame>
                      <align-len>57</align-len>
                      <gaps>0</gaps>
                      <qseq>LGQQDRVFFWSHTQFIVECVMPDLLHVIPVRHNTVFDWVFQCENTTFRLCFITDVAV</qseq>
                      <hseq>LCEKDWVFLGGDTEFIVEGVVPDLLHVIPVRDDSVFDGVFQSEDTSLALGLVTDVRV</hseq>
                      <midline>L ++D VF    T+FIVE V+PDLLHVIPVR ++VFD VFQ E+T+  L  +TDV V</midline>
                    </Hsp>
                    <Hsp>
                      <num>8</num>
                      <bit-score>38.1822</bit-score>
                      <score>77</score>
                      <evalue>4.23631e-16</evalue>
                      <identity>14</identity>
                      <positive>25</positive>
                      <query-from>75</query-from>
                      <query-to>173</query-to>
                      <query-frame>-1</query-frame>
                      <hit-from>288</hit-from>
                      <hit-to>386</hit-to>
                      <hit-frame>-2</hit-frame>
                      <align-len>33</align-len>
                      <gaps>0</gaps>
                      <qseq>LLTHTNHHTLMSRSSNDGREYCSWCIITSESQL</qseq>
                      <hseq>LLSHANHHTLVARAAHDRWEHGAGRVVTRETGL</hseq>
                      <midline>LL+H NHHTL++R+++D  E+ +  ++T E+ L</midline>
                    </Hsp>
                    <Hsp>
                      <num>9</num>
                      <bit-score>67.0494</bit-score>
                      <score>140</score>
                      <evalue>2.03996e-10</evalue>
                      <identity>32</identity>
                      <positive>37</positive>
                      <query-from>178</query-from>
                      <query-to>357</query-to>
                      <query-frame>1</query-frame>
                      <hit-from>392</hit-from>
                      <hit-to>571</hit-to>
                      <hit-frame>2</hit-frame>
                      <align-len>60</align-len>
                      <gaps>0</gaps>
                      <qseq>LRR**STIETWYSHTEIPNRTRYCDELG*HGEDLASHILQ*IACGSRRTPCPVDRAPLYP</qseq>
                      <hseq>VRR*RGPEQERYPHSEIPHRTRNRHELG*HGEDLAPHLLQ*TPCRPRGTPSPSHRGTPQP</hseq>
                      <midline>+RR*    +  Y H+EIP+RTR   ELG*HGEDLA H+LQ*  C  R TP P  R    P</midline>
                    </Hsp>
                    <Hsp>
                      <num>10</num>
                      <bit-score>26.727</bit-score>
                      <score>52</score>
                      <evalue>2.03996e-10</evalue>
                      <identity>8</identity>
                      <positive>12</positive>
                      <query-from>113</query-from>
                      <query-to>172</query-to>
                      <query-frame>2</query-frame>
                      <hit-from>326</hit-from>
                      <hit-to>385</hit-to>
                      <hit-frame>2</hit-frame>
                      <align-len>20</align-len>
                      <gaps>0</gaps>
                      <qseq>IPFHRWTTSTSRCDGWYGSK</qseq>
                      <hseq>VPIDRGPPSPPGCDGWHGTE</hseq>
                      <midline>+P  R   S   CDGW+G++</midline>
                    </Hsp>
                    <Hsp>
                      <num>11</num>
                      <bit-score>65.2165</bit-score>
                      <score>136</score>
                      <evalue>1.75538e-07</evalue>
                      <identity>29</identity>
                      <positive>33</positive>
                      <query-from>177</query-from>
                      <query-to>332</query-to>
                      <query-frame>-1</query-frame>
                      <hit-from>391</hit-from>
                      <hit-to>546</hit-to>
                      <hit-frame>-1</hit-frame>
                      <align-len>52</align-len>
                      <gaps>0</gaps>
                      <qseq>GQGVLLEPHAIHCRMCDARSSPCHPSSSQYRVRLGISV*EYHVSIVLHHRRS</qseq>
                      <hseq>GLGVPRGRHGVHCRRCGARSSPCHPSS*RFRVRWGISE*GYLSCSGPRHRRT</hseq>
                      <midline>G GV    H +HCR C ARSSPCHPSS ++RVR GIS * Y       HRR+</midline>
                    </Hsp>
                    <Hsp>
                      <num>12</num>
                      <bit-score>61.0927</bit-score>
                      <score>127</score>
                      <evalue>3.06042e-06</evalue>
                      <identity>31</identity>
                      <positive>35</positive>
                      <query-from>168</query-from>
                      <query-to>332</query-to>
                      <query-frame>3</query-frame>
                      <hit-from>382</hit-from>
                      <hit-to>546</hit-to>
                      <hit-frame>1</hit-frame>
                      <align-len>55</align-len>
                      <gaps>0</gaps>
                      <qseq>QKTATSVMKHNRNVVFSH*NTQSNTVL*RTGMTWRRSGITHSTMNCVWLQKNTLS</qseq>
                      <hseq>RRTRTSVTRPRAREVSSL*NTPSNTESSRTGMTWRRSGTTPSTMNSVSPPRNTQS</hseq>
                      <midline>++T TSV +     V S *NT SNT   RTGMTWRRSG T STMN V   +NT S</midline>
                    </Hsp>
                  </hsps>
                </Hit>
                <Hit>
                  <num>5</num>
                  <description>
                    <HitDescr>
                      <id>gi|1590279025|ref|XM_028307351.1|</id>
                      <accession>XM_028307351</accession>
                      <title>PREDICTED: Ostrinia furnacalis actin, cytoplasmic A3a (LOC114354791), mRNA</title>
                      <taxid>93504</taxid>
                      <sciname>Ostrinia furnacalis</sciname>
                    </HitDescr>
                  </description>
                  <len>1599</len>
                  <hsps>
                    <Hsp>
                      <num>1</num>
                      <bit-score>151.818</bit-score>
                      <score>325</score>
                      <evalue>7.83523e-61</evalue>
                      <identity>59</identity>
                      <positive>59</positive>
                      <query-from>164</query-from>
                      <query-to>343</query-to>
                      <query-frame>2</query-frame>
                      <hit-from>389</hit-from>
                      <hit-to>568</hit-to>
                      <hit-frame>2</hit-frame>
                      <align-len>60</align-len>
                      <gaps>0</gaps>
                      <qseq>GSKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE</qseq>
                      <hseq>GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE</hseq>
                      <midline>G KDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE</midline>
                    </Hsp>
                    <Hsp>
                      <num>2</num>
                      <bit-score>82.6285</bit-score>
                      <score>174</score>
                      <evalue>7.83523e-61</evalue>
                      <identity>33</identity>
                      <positive>33</positive>
                      <query-from>66</query-from>
                      <query-to>173</query-to>
                      <query-frame>3</query-frame>
                      <hit-from>290</hit-from>
                      <hit-to>397</hit-to>
                      <hit-frame>2</hit-frame>
                      <align-len>36</align-len>
                      <gaps>0</gaps>
                      <qseq>GCAKLGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK</qseq>
                      <hseq>GMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK</hseq>
                      <midline>G  K GFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK</midline>
                    </Hsp>
                    <Hsp>
                      <num>3</num>
                      <bit-score>47.3464</bit-score>
                      <score>97</score>
                      <evalue>7.83523e-61</evalue>
                      <identity>19</identity>
                      <positive>19</positive>
                      <query-from>20</query-from>
                      <query-to>82</query-to>
                      <query-frame>2</query-frame>
                      <hit-from>245</hit-from>
                      <hit-to>307</hit-to>
                      <hit-frame>2</hit-frame>
                      <align-len>21</align-len>
                      <gaps>0</gaps>
                      <qseq>MADEEVQALVVDNGSGMCKAG</qseq>
                      <hseq>MCDEEVAALVVDNGSGMCKAG</hseq>
                      <midline>M DEEV ALVVDNGSGMCKAG</midline>
                    </Hsp>
                    <Hsp>
                      <num>4</num>
                      <bit-score>105.997</bit-score>
                      <score>225</score>
                      <evalue>3.26469e-39</evalue>
                      <identity>48</identity>
                      <positive>52</positive>
                      <query-from>163</query-from>
                      <query-to>345</query-to>
                      <query-frame>-3</query-frame>
                      <hit-from>388</hit-from>
                      <hit-to>570</hit-to>
                      <hit-frame>-1</hit-frame>
                      <align-len>61</align-len>
                      <gaps>0</gaps>
                      <qseq>SSVNRTGCSSGATRNSL*NV*CQIFSMSSQFVTIPCSIGYFSVRIPRFDCASSPT*LSFDP</qseq>
                      <hseq>ASVRRTGCSSGATRSSL*KV*CQIFSMSSQFVTIPCSMGYLSVRMPLLLWASSPT*ESFCP</hseq>
                      <midline>+SV RTGCSSGATR+SL* V*CQIFSMSSQFVTIPCS+GY SVR+P    ASSPT* SF P</midline>
                    </Hsp>
                    <Hsp>
                      <num>5</num>
                      <bit-score>58.3434</bit-score>
                      <score>121</score>
                      <evalue>3.26469e-39</evalue>
                      <identity>24</identity>
                      <positive>28</positive>
                      <query-from>65</query-from>
                      <query-to>172</query-to>
                      <query-frame>-2</query-frame>
                      <hit-from>289</hit-from>
                      <hit-to>396</hit-to>
                      <hit-frame>-1</hit-frame>
                      <align-len>36</align-len>
                      <gaps>0</gaps>
                      <qseq>F*PIPTITP*CRGRPTMEGNTALGASSPANPSFAHP</qseq>
                      <hseq>FCPMPTITPWWRGRPTIDGNTARGASSPAKPALHIP</hseq>
                      <midline>F P+PTITP  RGRPT++GNTA GASSPA P+   P</midline>
                    </Hsp>
                    <Hsp>
                      <num>6</num>
                      <bit-score>44.5971</bit-score>
                      <score>91</score>
                      <evalue>3.26469e-39</evalue>
                      <identity>18</identity>
                      <positive>22</positive>
                      <query-from>4</query-from>
                      <query-to>81</query-to>
                      <query-frame>-3</query-frame>
                      <hit-from>229</hit-from>
                      <hit-to>306</hit-to>
                      <hit-frame>-1</hit-frame>
                      <align-len>26</align-len>
                      <gaps>0</gaps>
                      <qseq>PALHIPDPLSTTRA*TSSSAMIIFQL</qseq>
                      <hseq>PALHIPDPLSTTNAATSSSHILVYLL</hseq>
                      <midline>PALHIPDPLSTT A TSSS ++++ L</midline>
                    </Hsp>
                    <Hsp>
                      <num>7</num>
                      <bit-score>79.421</bit-score>
                      <score>167</score>
                      <evalue>2.27039e-16</evalue>
                      <identity>34</identity>
                      <positive>43</positive>
                      <query-from>170</query-from>
                      <query-to>340</query-to>
                      <query-frame>-2</query-frame>
                      <hit-from>395</hit-from>
                      <hit-to>565</hit-to>
                      <hit-frame>-3</hit-frame>
                      <align-len>57</align-len>
                      <gaps>0</gaps>
                      <qseq>GQQDRVFFWSHTQFIVECVMPDLLHVIPVRHNTVFDWVFQCENTTFRLCFITDVAVF</qseq>
                      <hseq>GKKDWVFLGSDTEFIVEGVMPDLLHVIPVCDDSVFDGVFECEDASLALGLISDVGVF</hseq>
                      <midline>G++D VF  S T+FIVE VMPDLLHVIPV  ++VFD VF+CE+ +  L  I+DV VF</midline>
                    </Hsp>
                    <Hsp>
                      <num>8</num>
                      <bit-score>34.5166</bit-score>
                      <score>69</score>
                      <evalue>2.27039e-16</evalue>
                      <identity>13</identity>
                      <positive>23</positive>
                      <query-from>75</query-from>
                      <query-to>170</query-to>
                      <query-frame>-1</query-frame>
                      <hit-from>299</hit-from>
                      <hit-to>394</hit-to>
                      <hit-frame>-3</hit-frame>
                      <align-len>32</align-len>
                      <gaps>0</gaps>
                      <qseq>LTHTNHHTLMSRSSNDGREYCSWCIITSESQL</qseq>
                      <hseq>LSHANHHTLVARAAHDRWEHGAGRVIARETGL</hseq>
                      <midline>L+H NHHTL++R+++D  E+ +  +I  E+ L</midline>
                    </Hsp>
                    <Hsp>
                      <num>9</num>
                      <bit-score>76.2135</bit-score>
                      <score>160</score>
                      <evalue>2.96635e-13</evalue>
                      <identity>36</identity>
                      <positive>44</positive>
                      <query-from>169</query-from>
                      <query-to>360</query-to>
                      <query-frame>1</query-frame>
                      <hit-from>394</hit-from>
                      <hit-to>585</hit-to>
                      <hit-frame>1</hit-frame>
                      <align-len>64</align-len>
                      <gaps>0</gaps>
                      <qseq>KRQLRR**STIETWYSHTEIPNRTRYCDELG*HGEDLASHILQ*IACGSRRTPCPVDRAPLYPK</qseq>
                      <hseq>KRLLRRR*GPEQERHPHTQIPHRTRNRHKLG*HGEDLASHLLQ*TPCRSRGTPSPSYRSPPEPQ</hseq>
                      <midline>KR LRR *   +  + HT+IP+RTR   +LG*HGEDLASH+LQ*  C SR TP P  R+P  P+</midline>
                    </Hsp>
                    <Hsp>
                      <num>10</num>
                      <bit-score>27.1852</bit-score>
                      <score>53</score>
                      <evalue>2.96635e-13</evalue>
                      <identity>8</identity>
                      <positive>12</positive>
                      <query-from>113</query-from>
                      <query-to>172</query-to>
                      <query-frame>2</query-frame>
                      <hit-from>337</hit-from>
                      <hit-to>396</hit-to>
                      <hit-frame>1</hit-frame>
                      <align-len>20</align-len>
                      <gaps>0</gaps>
                      <qseq>IPFHRWTTSTSRCDGWYGSK</qseq>
                      <hseq>VPIDRGPPAPPGCDGWHGTK</hseq>
                      <midline>+P  R   +   CDGW+G+K</midline>
                    </Hsp>
                    <Hsp>
                      <num>11</num>
                      <bit-score>67.9658</bit-score>
                      <score>142</score>
                      <evalue>2.61074e-08</evalue>
                      <identity>29</identity>
                      <positive>33</positive>
                      <query-from>216</query-from>
                      <query-to>359</query-to>
                      <query-frame>-1</query-frame>
                      <hit-from>441</hit-from>
                      <hit-to>584</hit-to>
                      <hit-frame>-2</hit-frame>
                      <align-len>48</align-len>
                      <gaps>0</gaps>
                      <qseq>FGYNGARSTGQGVLLEPHAIHCRMCDARSSPCHPSSSQYRVRLGISV*</qseq>
                      <hseq>WGSGGLR*EGLGVPRERHGVHCRRCDARSSPCHPSL*RFRVRWGI*V*</hseq>
                      <midline>+G  G R  G GV  E H +HCR CDARSSPCHPS  ++RVR GI V*</midline>
                    </Hsp>
                    <Hsp>
                      <num>12</num>
                      <bit-score>67.5076</bit-score>
                      <score>141</score>
                      <evalue>3.58672e-08</evalue>
                      <identity>33</identity>
                      <positive>37</positive>
                      <query-from>168</query-from>
                      <query-to>341</query-to>
                      <query-frame>3</query-frame>
                      <hit-from>393</hit-from>
                      <hit-to>566</hit-to>
                      <hit-frame>3</hit-frame>
                      <align-len>58</align-len>
                      <gaps>0</gaps>
                      <qseq>QKTATSVMKHNRNVVFSH*NTQSNTVL*RTGMTWRRSGITHSTMNCVWLQKNTLSC*P</qseq>
                      <hseq>KKTPTSEMRPRAREASSHSNTPSNTESSQTGMTWRRSGITPSTMNSVSLPRNTQSFLP</hseq>
                      <midline>+KT TS M+       SH NT SNT   +TGMTWRRSGIT STMN V L +NT S  P</midline>
                    </Hsp>
                  </hsps>
                </Hit>
                <Hit>
                  <num>6</num>
                  <description>
                    <HitDescr>
                      <id>gi|1578896738|gb|MK210584.1|</id>
                      <accession>MK210584</accession>
                      <title>Hermetia illucens beta-actin mRNA, complete cds</title>
                      <taxid>343691</taxid>
                      <sciname>Hermetia illucens</sciname>
                    </HitDescr>
                  </description>
                  <len>1131</len>
                  <hsps>
                    <Hsp>
                      <num>1</num>
                      <bit-score>151.818</bit-score>
                      <score>325</score>
                      <evalue>7.86904e-61</evalue>
                      <identity>59</identity>
                      <positive>59</positive>
                      <query-from>164</query-from>
                      <query-to>343</query-to>
                      <query-frame>2</query-frame>
                      <hit-from>145</hit-from>
                      <hit-to>324</hit-to>
                      <hit-frame>1</hit-frame>
                      <align-len>60</align-len>
                      <gaps>0</gaps>
                      <qseq>GSKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE</qseq>
                      <hseq>GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE</hseq>
                      <midline>G KDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE</midline>
                    </Hsp>
                    <Hsp>
                      <num>2</num>
                      <bit-score>82.6285</bit-score>
                      <score>174</score>
                      <evalue>7.86904e-61</evalue>
                      <identity>33</identity>
                      <positive>33</positive>
                      <query-from>66</query-from>
                      <query-to>173</query-to>
                      <query-frame>3</query-frame>
                      <hit-from>46</hit-from>
                      <hit-to>153</hit-to>
                      <hit-frame>1</hit-frame>
                      <align-len>36</align-len>
                      <gaps>0</gaps>
                      <qseq>GCAKLGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK</qseq>
                      <hseq>GMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK</hseq>
                      <midline>G  K GFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK</midline>
                    </Hsp>
                    <Hsp>
                      <num>3</num>
                      <bit-score>47.3464</bit-score>
                      <score>97</score>
                      <evalue>7.86904e-61</evalue>
                      <identity>19</identity>
                      <positive>19</positive>
                      <query-from>20</query-from>
                      <query-to>82</query-to>
                      <query-frame>2</query-frame>
                      <hit-from>1</hit-from>
                      <hit-to>63</hit-to>
                      <hit-frame>1</hit-frame>
                      <align-len>21</align-len>
                      <gaps>0</gaps>
                      <qseq>MADEEVQALVVDNGSGMCKAG</qseq>
                      <hseq>MCDEEVAALVVDNGSGMCKAG</hseq>
                      <midline>M DEEV ALVVDNGSGMCKAG</midline>
                    </Hsp>
                    <Hsp>
                      <num>4</num>
                      <bit-score>111.954</bit-score>
                      <score>238</score>
                      <evalue>4.65511e-42</evalue>
                      <identity>49</identity>
                      <positive>55</positive>
                      <query-from>163</query-from>
                      <query-to>360</query-to>
                      <query-frame>-3</query-frame>
                      <hit-from>144</hit-from>
                      <hit-to>341</hit-to>
                      <hit-frame>-2</hit-frame>
                      <align-len>66</align-len>
                      <gaps>0</gaps>
                      <qseq>FRIQWSSVNRTGCSSGATRNSL*NV*CQIFSMSSQFVTIPCSIGYFSVRIPRFDCASSPT*LSFDP</qseq>
                      <hseq>FGLSGASVNSTGCSSGATRSSL*KVWCQIFSISSQFVTIPCSMGYFNVRIPRLLCASSPTYESFWP</hseq>
                      <midline>F +  +SVN TGCSSGATR+SL* V CQIFS+SSQFVTIPCS+GYF+VRIPR  CASSPT  SF P</midline>
                    </Hsp>
                    <Hsp>
                      <num>5</num>
                      <bit-score>63.8419</bit-score>
                      <score>133</score>
                      <evalue>4.65511e-42</evalue>
                      <identity>26</identity>
                      <positive>29</positive>
                      <query-from>65</query-from>
                      <query-to>172</query-to>
                      <query-frame>-2</query-frame>
                      <hit-from>45</hit-from>
                      <hit-to>152</hit-to>
                      <hit-frame>-2</hit-frame>
                      <align-len>36</align-len>
                      <gaps>0</gaps>
                      <qseq>F*PIPTITP*CRGRPTMEGNTALGASSPANPSFAHP</qseq>
                      <hseq>FWPMPTITP*CLGRPTIEGNTARGASSPAKPALHIP</hseq>
                      <midline>F P+PTITP*C GRPT+EGNTA GASSPA P+   P</midline>
                    </Hsp>
                    <Hsp>
                      <num>6</num>
                      <bit-score>42.7643</bit-score>
                      <score>87</score>
                      <evalue>4.65511e-42</evalue>
                      <identity>18</identity>
                      <positive>18</positive>
                      <query-from>25</query-from>
                      <query-to>81</query-to>
                      <query-frame>-3</query-frame>
                      <hit-from>6</hit-from>
                      <hit-to>62</hit-to>
                      <hit-frame>-2</hit-frame>
                      <align-len>19</align-len>
                      <gaps>0</gaps>
                      <qseq>PALHIPDPLSTTRA*TSSS</qseq>
                      <hseq>PALHIPDPLSTTRAATSSS</hseq>
                      <midline>PALHIPDPLSTTRA TSSS</midline>
                    </Hsp>
                    <Hsp>
                      <num>7</num>
                      <bit-score>66.5912</bit-score>
                      <score>139</score>
                      <evalue>1.17801e-21</evalue>
                      <identity>26</identity>
                      <positive>40</positive>
                      <query-from>179</query-from>
                      <query-to>343</query-to>
                      <query-frame>-2</query-frame>
                      <hit-from>160</hit-from>
                      <hit-to>324</hit-to>
                      <hit-frame>-1</hit-frame>
                      <align-len>55</align-len>
                      <gaps>0</gaps>
                      <qseq>LGQQDRVFFWSHTQFIVECVMPDLLHVIPVRHNTVFDWVFQCENTTFRLCFITDV</qseq>
                      <hseq>LGQQHWVLLGGNSKFIVEGVVPDLLHIVPVCDDSMLNGVLQCEDTSLALCFVSYV</hseq>
                      <midline>LGQQ  V    +++FIVE V+PDLLH++PV  +++ + V QCE+T+  LCF++ V</midline>
                    </Hsp>
                    <Hsp>
                      <num>8</num>
                      <bit-score>49.6374</bit-score>
                      <score>102</score>
                      <evalue>1.17801e-21</evalue>
                      <identity>17</identity>
                      <positive>25</positive>
                      <query-from>75</query-from>
                      <query-to>173</query-to>
                      <query-frame>-1</query-frame>
                      <hit-from>55</hit-from>
                      <hit-to>153</hit-to>
                      <hit-frame>-1</hit-frame>
                      <align-len>33</align-len>
                      <gaps>0</gaps>
                      <qseq>LLTHTNHHTLMSRSSNDGREYCSWCIITSESQL</qseq>
                      <hseq>LLAHADHHTLMPWAADDRREHGAWCIVTGEASL</hseq>
                      <midline>LL H +HHTLM  +++D RE+ +WCI+T E+ L</midline>
                    </Hsp>
                    <Hsp>
                      <num>9</num>
                      <bit-score>33.1419</bit-score>
                      <score>66</score>
                      <evalue>1.17801e-21</evalue>
                      <identity>13</identity>
                      <positive>15</positive>
                      <query-from>20</query-from>
                      <query-to>79</query-to>
                      <query-frame>-2</query-frame>
                      <hit-from>1</hit-from>
                      <hit-to>60</hit-to>
                      <hit-frame>-1</hit-frame>
                      <align-len>20</align-len>
                      <gaps>0</gaps>
                      <qseq>SFAHP*SIINNEGLNFFVGH</qseq>
                      <hseq>SLAHTRSIVDNEGSNFFVTH</hseq>
                      <midline>S AH  SI++NEG NFFV H</midline>
                    </Hsp>
                    <Hsp>
                      <num>10</num>
                      <bit-score>51.4703</bit-score>
                      <score>106</score>
                      <evalue>6.47459e-10</evalue>
                      <identity>27</identity>
                      <positive>35</positive>
                      <query-from>169</query-from>
                      <query-to>360</query-to>
                      <query-frame>1</query-frame>
                      <hit-from>150</hit-from>
                      <hit-to>341</hit-to>
                      <hit-frame>3</hit-frame>
                      <align-len>64</align-len>
                      <gaps>0</gaps>
                      <qseq>KRQLRR**STIETWYSHTEIPNRTRYCDELG*HGEDLASHILQ*IACGSRRTPCPVDRAPLYPK</qseq>
                      <hseq>KGLIRRRRSTKQARYPHIEVPH*AWNRHKLGRYGEDLAPHLLQ*TSSCPRGAPSAVDRGSTQPK</hseq>
                      <midline>K  +RR  ST +  Y H E+P+      +LG +GEDLA H+LQ* +   R  P  VDR    PK</midline>
                    </Hsp>
                    <Hsp>
                      <num>11</num>
                      <bit-score>29.9345</bit-score>
                      <score>59</score>
                      <evalue>6.47459e-10</evalue>
                      <identity>13</identity>
                      <positive>16</positive>
                      <query-from>83</query-from>
                      <query-to>172</query-to>
                      <query-frame>2</query-frame>
                      <hit-from>63</hit-from>
                      <hit-to>152</hit-to>
                      <hit-frame>3</hit-frame>
                      <align-len>30</align-len>
                      <gaps>0</gaps>
                      <qseq>IRW**CTKSSIPFHRWTTSTSRCDGWYGSK</qseq>
                      <hseq>LRR*RCTTRRVPFDRRPPKASGCDGRHGPK</hseq>
                      <midline>+R * CT   +PF R     S CDG +G K</midline>
                    </Hsp>
                    <Hsp>
                      <num>12</num>
                      <bit-score>27.6434</bit-score>
                      <score>54</score>
                      <evalue>6.47459e-10</evalue>
                      <identity>11</identity>
                      <positive>11</positive>
                      <query-from>28</query-from>
                      <query-to>81</query-to>
                      <query-frame>1</query-frame>
                      <hit-from>9</hit-from>
                      <hit-to>62</hit-to>
                      <hit-frame>3</hit-frame>
                      <align-len>18</align-len>
                      <gaps>0</gaps>
                      <qseq>RRSSSPRC**WIRDVQSW</qseq>
                      <hseq>RRSCCPRCRQWIWYVQGW</hseq>
                      <midline>RRS  PRC  WI  VQ W</midline>
                    </Hsp>
                    <Hsp>
                      <num>13</num>
                      <bit-score>48.721</bit-score>
                      <score>100</score>
                      <evalue>4.54954e-08</evalue>
                      <identity>25</identity>
                      <positive>33</positive>
                      <query-from>168</query-from>
                      <query-to>341</query-to>
                      <query-frame>3</query-frame>
                      <hit-from>149</hit-from>
                      <hit-to>322</hit-to>
                      <hit-frame>2</hit-frame>
                      <align-len>58</align-len>
                      <gaps>0</gaps>
                      <qseq>QKTATSVMKHNRNVVFSH*NTQSNTVL*RTGMTWRRSGITHSTMNCVWLQKNTLSC*P</qseq>
                      <hseq>KRTHT*ETKHKASEVSSH*STPLSMESSQTGTIWRRSGTTPSTMNFELPPRSTQCC*P</hseq>
                      <midline>++T T   KH  + V SH*+T  +    +TG  WRRSG T STMN     ++T  C*P</midline>
                    </Hsp>
                    <Hsp>
                      <num>14</num>
                      <bit-score>28.1016</bit-score>
                      <score>55</score>
                      <evalue>4.54954e-08</evalue>
                      <identity>14</identity>
                      <positive>15</positive>
                      <query-from>85</query-from>
                      <query-to>174</query-to>
                      <query-frame>1</query-frame>
                      <hit-from>65</hit-from>
                      <hit-to>154</hit-to>
                      <hit-frame>2</hit-frame>
                      <align-len>30</align-len>
                      <gaps>0</gaps>
                      <qseq>SLVMMHQEQYSLPSLDDLDIKV*WLVWVKR</qseq>
                      <hseq>SPVTMHHAPCSLRSSAAQGIRV*WSAWAKR</hseq>
                      <midline>S V MH    SL S     I+V*W  W KR</midline>
                    </Hsp>
                    <Hsp>
                      <num>15</num>
                      <bit-score>25.8106</bit-score>
                      <score>50</score>
                      <evalue>4.54954e-08</evalue>
                      <identity>11</identity>
                      <positive>12</positive>
                      <query-from>27</query-from>
                      <query-to>80</query-to>
                      <query-frame>3</query-frame>
                      <hit-from>8</hit-from>
                      <hit-to>61</hit-to>
                      <hit-frame>2</hit-frame>
                      <align-len>18</align-len>
                      <gaps>0</gaps>
                      <qseq>TKKFKPSLLIMDQGCAKL</qseq>
                      <hseq>TKKLLPSLSTMDLVCARL</hseq>
                      <midline>TKK  PSL  MD  CA+L</midline>
                    </Hsp>
                    <Hsp>
                      <num>16</num>
                      <bit-score>43.2225</bit-score>
                      <score>88</score>
                      <evalue>6.15961e-08</evalue>
                      <identity>21</identity>
                      <positive>26</positive>
                      <query-from>192</query-from>
                      <query-to>341</query-to>
                      <query-frame>-1</query-frame>
                      <hit-from>173</hit-from>
                      <hit-to>322</hit-to>
                      <hit-frame>-3</hit-frame>
                      <align-len>50</align-len>
                      <gaps>0</gaps>
                      <qseq>RSTGQGVLLEPHAIHCRMCDARSSPCHPSSSQYRVRLGISV*EYHVSIVL</qseq>
                      <hseq>RSTALGAPRGQLEVHCRRCGARSSPYRPSL*RFHAQWGTSM*GYLACFVL</hseq>
                      <midline>RST  G       +HCR C ARSSP  PS  ++  + G S+* Y    VL</midline>
                    </Hsp>
                    <Hsp>
                      <num>17</num>
                      <bit-score>30.3927</bit-score>
                      <score>60</score>
                      <evalue>6.15961e-08</evalue>
                      <identity>13</identity>
                      <positive>17</positive>
                      <query-from>85</query-from>
                      <query-to>171</query-to>
                      <query-frame>-3</query-frame>
                      <hit-from>65</hit-from>
                      <hit-to>151</hit-to>
                      <hit-frame>-3</hit-frame>
                      <align-len>29</align-len>
                      <gaps>0</gaps>
                      <qseq>FDPYQPSHLDVEVVQRWKGILLLVHHHQR</qseq>
                      <hseq>FGPCRPSHPDALGGRRSKGTRRVVHRHRR</hseq>
                      <midline>F P +PSH D    +R KG   +VH H+R</midline>
                    </Hsp>
                    <Hsp>
                      <num>18</num>
                      <bit-score>28.5598</bit-score>
                      <score>56</score>
                      <evalue>6.15961e-08</evalue>
                      <identity>12</identity>
                      <positive>14</positive>
                      <query-from>27</query-from>
                      <query-to>83</query-to>
                      <query-frame>-1</query-frame>
                      <hit-from>8</hit-from>
                      <hit-to>64</hit-to>
                      <hit-frame>-3</hit-frame>
                      <align-len>19</align-len>
                      <gaps>0</gaps>
                      <qseq>SQLCTSLIHYQQRGLELLR</qseq>
                      <hseq>SQPCTYQIHCRQRGQQLLR</hseq>
                      <midline>SQ CT  IH +QRG +LLR</midline>
                    </Hsp>
                  </hsps>
                </Hit>
                <Hit>
                  <num>7</num>
                  <description>
                    <HitDescr>
                      <id>gi|1561747529|ref|XM_007065846.2|</id>
                      <accession>XM_007065846</accession>
                      <title>PREDICTED: Chelonia mydas actin, cytoplasmic type 5 (LOC102932532), mRNA</title>
                      <taxid>8469</taxid>
                      <sciname>Chelonia mydas</sciname>
                    </HitDescr>
                  </description>
                  <len>1782</len>
                  <hsps>
                    <Hsp>
                      <num>1</num>
                      <bit-score>151.818</bit-score>
                      <score>325</score>
                      <evalue>2.22999e-61</evalue>
                      <identity>59</identity>
                      <positive>59</positive>
                      <query-from>164</query-from>
                      <query-to>343</query-to>
                      <query-frame>2</query-frame>
                      <hit-from>180</hit-from>
                      <hit-to>359</hit-to>
                      <hit-frame>3</hit-frame>
                      <align-len>60</align-len>
                      <gaps>0</gaps>
                      <qseq>GSKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE</qseq>
                      <hseq>GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE</hseq>
                      <midline>G KDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE</midline>
                    </Hsp>
                    <Hsp>
                      <num>2</num>
                      <bit-score>82.6285</bit-score>
                      <score>174</score>
                      <evalue>2.22999e-61</evalue>
                      <identity>33</identity>
                      <positive>33</positive>
                      <query-from>66</query-from>
                      <query-to>173</query-to>
                      <query-frame>3</query-frame>
                      <hit-from>81</hit-from>
                      <hit-to>188</hit-to>
                      <hit-frame>3</hit-frame>
                      <align-len>36</align-len>
                      <gaps>0</gaps>
                      <qseq>GCAKLGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK</qseq>
                      <hseq>GMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK</hseq>
                      <midline>G  K GFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK</midline>
                    </Hsp>
                    <Hsp>
                      <num>3</num>
                      <bit-score>49.1792</bit-score>
                      <score>101</score>
                      <evalue>2.22999e-61</evalue>
                      <identity>20</identity>
                      <positive>21</positive>
                      <query-from>14</query-from>
                      <query-to>82</query-to>
                      <query-frame>2</query-frame>
                      <hit-from>30</hit-from>
                      <hit-to>98</hit-to>
                      <hit-frame>3</hit-frame>
                      <align-len>23</align-len>
                      <gaps>0</gaps>
                      <qseq>IIMADEEVQALVVDNGSGMCKAG</qseq>
                      <hseq>IKMADEEIAALVVDNGSGMCKAG</hseq>
                      <midline>I MADEE+ ALVVDNGSGMCKAG</midline>
                    </Hsp>
                    <Hsp>
                      <num>4</num>
                      <bit-score>102.79</bit-score>
                      <score>218</score>
                      <evalue>6.84013e-40</evalue>
                      <identity>46</identity>
                      <positive>52</positive>
                      <query-from>163</query-from>
                      <query-to>345</query-to>
                      <query-frame>-3</query-frame>
                      <hit-from>179</hit-from>
                      <hit-to>361</hit-to>
                      <hit-frame>-3</hit-frame>
                      <align-len>61</align-len>
                      <gaps>0</gaps>
                      <qseq>SSVNRTGCSSGATRNSL*NV*CQIFSMSSQFVTIPCSIGYFSVRIPRFDCASSPT*LSFDP</qseq>
                      <hseq>ASVSRTGCSSGATRSSL*KVWCQIFSMSSQLVTMPCSMGYFRVRMPLLL*ASSPT*LSFCP</hseq>
                      <midline>+SV+RTGCSSGATR+SL* V CQIFSMSSQ VT+PCS+GYF VR+P    ASSPT*LSF P</midline>
                    </Hsp>
                    <Hsp>
                      <num>5</num>
                      <bit-score>64.7583</bit-score>
                      <score>135</score>
                      <evalue>6.84013e-40</evalue>
                      <identity>26</identity>
                      <positive>29</positive>
                      <query-from>65</query-from>
                      <query-to>172</query-to>
                      <query-frame>-2</query-frame>
                      <hit-from>80</hit-from>
                      <hit-to>187</hit-to>
                      <hit-frame>-3</hit-frame>
                      <align-len>36</align-len>
                      <gaps>0</gaps>
                      <qseq>F*PIPTITP*CRGRPTMEGNTALGASSPANPSFAHP</qseq>
                      <hseq>FCPMPTMTPWCLGRPTMEGNTARGASSPANPALHIP</hseq>
                      <midline>F P+PT+TP C GRPTMEGNTA GASSPANP+   P</midline>
                    </Hsp>
                    <Hsp>
                      <num>6</num>
                      <bit-score>43.6807</bit-score>
                      <score>89</score>
                      <evalue>6.84013e-40</evalue>
                      <identity>15</identity>
                      <positive>20</positive>
                      <query-from>20</query-from>
                      <query-to>91</query-to>
                      <query-frame>-2</query-frame>
                      <hit-from>36</hit-from>
                      <hit-to>107</hit-to>
                      <hit-frame>-2</hit-frame>
                      <align-len>24</align-len>
                      <gaps>0</gaps>
                      <qseq>PANPSFAHP*SIINNEGLNFFVGH</qseq>
                      <hseq>PSKSSFAHPGAIVNNEGGDFFIGH</hseq>
                      <midline>P+  SFAHP +I+NNEG +FF+GH</midline>
                    </Hsp>
                    <Hsp>
                      <num>7</num>
                      <bit-score>59.718</bit-score>
                      <score>124</score>
                      <evalue>2.64948e-16</evalue>
                      <identity>27</identity>
                      <positive>35</positive>
                      <query-from>164</query-from>
                      <query-to>337</query-to>
                      <query-frame>-2</query-frame>
                      <hit-from>180</hit-from>
                      <hit-to>353</hit-to>
                      <hit-frame>-2</hit-frame>
                      <align-len>58</align-len>
                      <gaps>0</gaps>
                      <qseq>QQDRVFFWSHTQFIVECVMPDLLHVIPVRHNTVFDWVFQCENTTFRLCFITDVAVF*P</qseq>
                      <hseq>EQDRVLLRGNPQLIVESVVPDLLHVIPVGDNAMLNGILQGEDASLALSLIAHVAVLLP</hseq>
                      <midline>+QDRV    + Q IVE V+PDLLHVIPV  N + + + Q E+ +  L  I  VAV  P</midline>
                    </Hsp>
                    <Hsp>
                      <num>8</num>
                      <bit-score>43.2225</bit-score>
                      <score>88</score>
                      <evalue>2.64948e-16</evalue>
                      <identity>18</identity>
                      <positive>21</positive>
                      <query-from>13</query-from>
                      <query-to>81</query-to>
                      <query-frame>-3</query-frame>
                      <hit-from>29</hit-from>
                      <hit-to>97</hit-to>
                      <hit-frame>-3</hit-frame>
                      <align-len>23</align-len>
                      <gaps>0</gaps>
                      <qseq>PALHIPDPLSTTRA*TSSSAMII</qseq>
                      <hseq>PALHIPEPLSTTRAAISSSAILI</hseq>
                      <midline>PALHIP+PLSTTRA  SSSA++I</midline>
                    </Hsp>
                    <Hsp>
                      <num>9</num>
                      <bit-score>28.1016</bit-score>
                      <score>55</score>
                      <evalue>2.64948e-16</evalue>
                      <identity>13</identity>
                      <positive>14</positive>
                      <query-from>82</query-from>
                      <query-to>165</query-to>
                      <query-frame>-3</query-frame>
                      <hit-from>97</hit-from>
                      <hit-to>180</hit-to>
                      <hit-frame>-1</hit-frame>
                      <align-len>28</align-len>
                      <gaps>0</gaps>
                      <qseq>PYQPSHLDVEVVQRWKGILLLVHHHQRI</qseq>
                      <hseq>PCPP*HPGAWGVPRWKGTRLEEHHPQQI</hseq>
                      <midline>P  P H     V RWKG  L  HH Q+I</midline>
                    </Hsp>
                    <Hsp>
                      <num>10</num>
                      <bit-score>52.8449</bit-score>
                      <score>109</score>
                      <evalue>2.27725e-15</evalue>
                      <identity>26</identity>
                      <positive>34</positive>
                      <query-from>165</query-from>
                      <query-to>335</query-to>
                      <query-frame>3</query-frame>
                      <hit-from>181</hit-from>
                      <hit-to>351</hit-to>
                      <hit-frame>1</hit-frame>
                      <align-len>57</align-len>
                      <gaps>0</gaps>
                      <qseq>GQKTATSVMKHNRNVVFSH*NTQSNTVL*RTGMTWRRSGITHSTMNCVWLQKNTLSC</qseq>
                      <hseq>GRRTATWAMRLRAREASSP*SIPLSMALSPTGMTWRRSGTTLSTMSCGLPLRSTLSC</hseq>
                      <midline>G++TAT  M+       S *+   +  L  TGMTWRRSG T STM+C    ++TLSC</midline>
                    </Hsp>
                    <Hsp>
                      <num>11</num>
                      <bit-score>38.6404</bit-score>
                      <score>78</score>
                      <evalue>2.27725e-15</evalue>
                      <identity>14</identity>
                      <positive>17</positive>
                      <query-from>19</query-from>
                      <query-to>81</query-to>
                      <query-frame>1</query-frame>
                      <hit-from>35</hit-from>
                      <hit-to>97</hit-to>
                      <hit-frame>2</hit-frame>
                      <align-len>21</align-len>
                      <gaps>0</gaps>
                      <qseq>HGRRRSSSPRC**WIRDVQSW</qseq>
                      <hseq>NGR*RNRRPRC*QWLRDVQSW</hseq>
                      <midline>+GR R+  PRC* W+RDVQSW</midline>
                    </Hsp>
                    <Hsp>
                      <num>12</num>
                      <bit-score>36.3494</bit-score>
                      <score>73</score>
                      <evalue>2.27725e-15</evalue>
                      <identity>14</identity>
                      <positive>19</positive>
                      <query-from>83</query-from>
                      <query-to>187</query-to>
                      <query-frame>2</query-frame>
                      <hit-from>98</hit-from>
                      <hit-to>202</hit-to>
                      <hit-frame>2</hit-frame>
                      <align-len>35</align-len>
                      <gaps>0</gaps>
                      <qseq>IRW**CTKSSIPFHRWTTSTSRCDGWYGSKDSYVG</qseq>
                      <hseq>ICWG*CSSSRVPFHRGTPQAPGCHGGHGAEGQLRG</hseq>
                      <midline>I W *C+ S +PFHR T     C G +G++    G</midline>
                    </Hsp>
                    <Hsp>
                      <num>13</num>
                      <bit-score>50.0956</bit-score>
                      <score>103</score>
                      <evalue>1.1515e-08</evalue>
                      <identity>25</identity>
                      <positive>33</positive>
                      <query-from>175</query-from>
                      <query-to>348</query-to>
                      <query-frame>1</query-frame>
                      <hit-from>191</hit-from>
                      <hit-to>364</hit-to>
                      <hit-frame>2</hit-frame>
                      <align-len>58</align-len>
                      <gaps>0</gaps>
                      <qseq>QLRR**STIETWYSHTEIPNRTRYCDELG*HGEDLASHILQ*IACGSRRTPCPVDRAP</qseq>
                      <hseq>QLRGR*GSEQERHPHPEVSH*AWHCHQLG*HGEDLAPHFLQ*AAGCP*GAPCPAH*SP</hseq>
                      <midline>QLR  * + +  + H E+ +   +C +LG*HGEDLA H LQ* A      PCP   +P</midline>
                    </Hsp>
                    <Hsp>
                      <num>14</num>
                      <bit-score>37.724</bit-score>
                      <score>76</score>
                      <evalue>1.1515e-08</evalue>
                      <identity>15</identity>
                      <positive>15</positive>
                      <query-from>21</query-from>
                      <query-to>92</query-to>
                      <query-frame>3</query-frame>
                      <hit-from>37</hit-from>
                      <hit-to>108</hit-to>
                      <hit-frame>1</hit-frame>
                      <align-len>24</align-len>
                      <gaps>0</gaps>
                      <qseq>WPTKKFKPSLLIMDQGCAKLGFAG</qseq>
                      <hseq>WPMKKSPPSLLTMAPGCAKLDLLG</hseq>
                      <midline>WP KK  PSLL M  GCAKL   G</midline>
                    </Hsp>
                    <Hsp>
                      <num>15</num>
                      <bit-score>45.5136</bit-score>
                      <score>93</score>
                      <evalue>3.85196e-05</evalue>
                      <identity>18</identity>
                      <positive>19</positive>
                      <query-from>255</query-from>
                      <query-to>347</query-to>
                      <query-frame>-1</query-frame>
                      <hit-from>271</hit-from>
                      <hit-to>363</hit-to>
                      <hit-frame>-1</hit-frame>
                      <align-len>31</align-len>
                      <gaps>0</gaps>
                      <qseq>GARSTGQGVLLEPHAIHCRMCDARSSPCHPS</qseq>
                      <hseq>GLQ*AGQGAPQGQPAAHCRKCGARSSPCHPS</hseq>
                      <midline>G +  GQG      A HCR C ARSSPCHPS</midline>
                    </Hsp>
                    <Hsp>
                      <num>16</num>
                      <bit-score>32.2255</bit-score>
                      <score>64</score>
                      <evalue>3.85196e-05</evalue>
                      <identity>13</identity>
                      <positive>13</positive>
                      <query-from>21</query-from>
                      <query-to>80</query-to>
                      <query-frame>-1</query-frame>
                      <hit-from>37</hit-from>
                      <hit-to>96</hit-to>
                      <hit-frame>-1</hit-frame>
                      <align-len>20</align-len>
                      <gaps>0</gaps>
                      <qseq>QLCTSLIHYQQRGLELLRRP</qseq>
                      <hseq>QLCTSRSHCQQRGRRFLHRP</hseq>
                      <midline>QLCTS  H QQRG   L RP</midline>
                    </Hsp>
                  </hsps>
                </Hit>
                <Hit>
                  <num>8</num>
                  <description>
                    <HitDescr>
                      <id>gi|1561874797|ref|XM_027858255.1|</id>
                      <accession>XM_027858255</accession>
                      <title>PREDICTED: Vombatus ursinus actin, cytoplasmic type 5 (LOC114040221), mRNA</title>
                      <taxid>29139</taxid>
                      <sciname>Vombatus ursinus</sciname>
                    </HitDescr>
                  </description>
                  <len>1604</len>
                  <hsps>
                    <Hsp>
                      <num>1</num>
                      <bit-score>151.818</bit-score>
                      <score>325</score>
                      <evalue>3.0561e-61</evalue>
                      <identity>59</identity>
                      <positive>59</positive>
                      <query-from>164</query-from>
                      <query-to>343</query-to>
                      <query-frame>2</query-frame>
                      <hit-from>255</hit-from>
                      <hit-to>434</hit-to>
                      <hit-frame>3</hit-frame>
                      <align-len>60</align-len>
                      <gaps>0</gaps>
                      <qseq>GSKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE</qseq>
                      <hseq>GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE</hseq>
                      <midline>G KDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE</midline>
                    </Hsp>
                    <Hsp>
                      <num>2</num>
                      <bit-score>82.6285</bit-score>
                      <score>174</score>
                      <evalue>3.0561e-61</evalue>
                      <identity>33</identity>
                      <positive>33</positive>
                      <query-from>66</query-from>
                      <query-to>173</query-to>
                      <query-frame>3</query-frame>
                      <hit-from>156</hit-from>
                      <hit-to>263</hit-to>
                      <hit-frame>3</hit-frame>
                      <align-len>36</align-len>
                      <gaps>0</gaps>
                      <qseq>GCAKLGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK</qseq>
                      <hseq>GMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK</hseq>
                      <midline>G  K GFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK</midline>
                    </Hsp>
                    <Hsp>
                      <num>3</num>
                      <bit-score>48.721</bit-score>
                      <score>100</score>
                      <evalue>3.0561e-61</evalue>
                      <identity>19</identity>
                      <positive>20</positive>
                      <query-from>20</query-from>
                      <query-to>82</query-to>
                      <query-frame>2</query-frame>
                      <hit-from>111</hit-from>
                      <hit-to>173</hit-to>
                      <hit-frame>3</hit-frame>
                      <align-len>21</align-len>
                      <gaps>0</gaps>
                      <qseq>MADEEVQALVVDNGSGMCKAG</qseq>
                      <hseq>MADEEIAALVVDNGSGMCKAG</hseq>
                      <midline>MADEE+ ALVVDNGSGMCKAG</midline>
                    </Hsp>
                    <Hsp>
                      <num>4</num>
                      <bit-score>104.622</bit-score>
                      <score>222</score>
                      <evalue>1.13783e-38</evalue>
                      <identity>48</identity>
                      <positive>53</positive>
                      <query-from>163</query-from>
                      <query-to>360</query-to>
                      <query-frame>-3</query-frame>
                      <hit-from>254</hit-from>
                      <hit-to>451</hit-to>
                      <hit-frame>-2</hit-frame>
                      <align-len>66</align-len>
                      <gaps>0</gaps>
                      <qseq>FRIQWSSVNRTGCSSGATRNSL*NV*CQIFSMSSQFVTIPCSIGYFSVRIPRFDCASSPT*LSFDP</qseq>
                      <hseq>FGFRGASVSRTGCSSGATLSSL*KVWCQIFSMSSQLVTIPCSIGYFRVRMPLLLWASSPT*LSFCP</hseq>
                      <midline>F  + +SV+RTGCSSGAT +SL* V CQIFSMSSQ VTIPCSIGYF VR+P    ASSPT*LSF P</midline>
                    </Hsp>
                    <Hsp>
                      <num>5</num>
                      <bit-score>62.4673</bit-score>
                      <score>130</score>
                      <evalue>1.13783e-38</evalue>
                      <identity>25</identity>
                      <positive>28</positive>
                      <query-from>65</query-from>
                      <query-to>172</query-to>
                      <query-frame>-2</query-frame>
                      <hit-from>155</hit-from>
                      <hit-to>262</hit-to>
                      <hit-frame>-2</hit-frame>
                      <align-len>36</align-len>
                      <gaps>0</gaps>
                      <qseq>F*PIPTITP*CRGRPTMEGNTALGASSPANPSFAHP</qseq>
                      <hseq>FCPMPTMTPWCLGRPTMEGNTARGASSPAKPALHMP</hseq>
                      <midline>F P+PT+TP C GRPTMEGNTA GASSPA P+   P</midline>
                    </Hsp>
                    <Hsp>
                      <num>6</num>
                      <bit-score>40.0151</bit-score>
                      <score>81</score>
                      <evalue>1.13783e-38</evalue>
                      <identity>16</identity>
                      <positive>20</positive>
                      <query-from>16</query-from>
                      <query-to>81</query-to>
                      <query-frame>-3</query-frame>
                      <hit-from>107</hit-from>
                      <hit-to>172</hit-to>
                      <hit-frame>-2</hit-frame>
                      <align-len>22</align-len>
                      <gaps>0</gaps>
                      <qseq>PALHIPDPLSTTRA*TSSSAMI</qseq>
                      <hseq>PALHMPEPLSTTRAAISSSAIL</hseq>
                      <midline>PALH+P+PLSTTRA  SSSA++</midline>
                    </Hsp>
                    <Hsp>
                      <num>7</num>
                      <bit-score>68.424</bit-score>
                      <score>143</score>
                      <evalue>4.89102e-12</evalue>
                      <identity>24</identity>
                      <positive>38</positive>
                      <query-from>164</query-from>
                      <query-to>337</query-to>
                      <query-frame>-2</query-frame>
                      <hit-from>255</hit-from>
                      <hit-to>428</hit-to>
                      <hit-frame>-1</hit-frame>
                      <align-len>58</align-len>
                      <gaps>0</gaps>
                      <qseq>QQDRVFFWSHTQFIVECVMPDLLHVIPVRHNTVFDWVFQCENTTFRLCFITDVAVF*P</qseq>
                      <hseq>EQNRVLLWGYSELVVESVVPDFFHVIPVGDNTMLNWILQGKDAPFTLGLITHIAILLP</hseq>
                      <midline>+Q+RV  W +++ +VE V+PD  HVIPV  NT+ +W+ Q ++  F L  IT +A+  P</midline>
                    </Hsp>
                    <Hsp>
                      <num>8</num>
                      <bit-score>30.8509</bit-score>
                      <score>61</score>
                      <evalue>4.89102e-12</evalue>
                      <identity>12</identity>
                      <positive>22</positive>
                      <query-from>75</query-from>
                      <query-to>173</query-to>
                      <query-frame>-1</query-frame>
                      <hit-from>165</hit-from>
                      <hit-to>263</hit-to>
                      <hit-frame>-1</hit-frame>
                      <align-len>33</align-len>
                      <gaps>0</gaps>
                      <qseq>LLTHTNHHTLMSRSSNDGREYCSWCIITSESQL</qseq>
                      <hseq>LLPHANHDSLVPGATHDGRKHSPRGIISGKASL</hseq>
                      <midline>LL H NH +L+  +++DGR++    II+ ++ L</midline>
                    </Hsp>
                    <Hsp>
                      <num>9</num>
                      <bit-score>47.8046</bit-score>
                      <score>98</score>
                      <evalue>2.62741e-05</evalue>
                      <identity>20</identity>
                      <positive>27</positive>
                      <query-from>211</query-from>
                      <query-to>360</query-to>
                      <query-frame>1</query-frame>
                      <hit-from>302</hit-from>
                      <hit-to>451</hit-to>
                      <hit-frame>2</hit-frame>
                      <align-len>50</align-len>
                      <gaps>0</gaps>
                      <qseq>YSHTEIPNRTRYCDELG*HGEDLASHILQ*IACGSRRTPCPVDRAPLYPK</qseq>
                      <hseq>HPYPEVSN*AWYCHQLG*HGKNLAPHFLQRAQSSPRGAPCSAHRSTSEPK</hseq>
                      <midline>+ + E+ N   YC +LG*HG++LA H LQ      R  PC   R+   PK</midline>
                    </Hsp>
                    <Hsp>
                      <num>10</num>
                      <bit-score>28.5598</bit-score>
                      <score>56</score>
                      <evalue>2.62741e-05</evalue>
                      <identity>9</identity>
                      <positive>14</positive>
                      <query-from>95</query-from>
                      <query-to>172</query-to>
                      <query-frame>2</query-frame>
                      <hit-from>185</hit-from>
                      <hit-to>262</hit-to>
                      <hit-frame>2</hit-frame>
                      <align-len>26</align-len>
                      <gaps>0</gaps>
                      <qseq>*CTKSSIPFHRWTTSTSRCDGWYGSK</qseq>
                      <hseq>*CPSGCVSFHRGSPQAPRSHGWHGAE</hseq>
                      <midline>*C    + FHR +    R  GW+G++</midline>
                    </Hsp>
                    <Hsp>
                      <num>11</num>
                      <bit-score>40.0151</bit-score>
                      <score>81</score>
                      <evalue>6.7728</evalue>
                      <identity>22</identity>
                      <positive>32</positive>
                      <query-from>165</query-from>
                      <query-to>335</query-to>
                      <query-frame>3</query-frame>
                      <hit-from>256</hit-from>
                      <hit-to>426</hit-to>
                      <hit-frame>1</hit-frame>
                      <align-len>57</align-len>
                      <gaps>0</gaps>
                      <qseq>GQKTATSVMKHNRNVVFSH*NTQSNTVL*RTGMTWRRSGITHSTMNCVWLQKNTLSC</qseq>
                      <hseq>GRRIAMWVMRPRVKGASLP*SIQLSMVLSPTGMTWKKSGTTLSTTSSE*PQRSTLFC</hseq>
                      <midline>G++ A  VM+         *+ Q + VL  TGMTW++SG T ST +    Q++TL C</midline>
                    </Hsp>
                  </hsps>
                </Hit>
                <Hit>
                  <num>9</num>
                  <description>
                    <HitDescr>
                      <id>gi|1561775767|ref|XM_027888585.1|</id>
                      <accession>XM_027888585</accession>
                      <title>PREDICTED: Empidonax traillii actin, cytoplasmic type 5 (LOC114059764), transcript variant X1, mRNA</title>
                      <taxid>164674</taxid>
                      <sciname>Empidonax traillii</sciname>
                    </HitDescr>
                  </description>
                  <len>1599</len>
                  <hsps>
                    <Hsp>
                      <num>1</num>
                      <bit-score>151.818</bit-score>
                      <score>325</score>
                      <evalue>3.05617e-61</evalue>
                      <identity>59</identity>
                      <positive>59</positive>
                      <query-from>164</query-from>
                      <query-to>343</query-to>
                      <query-frame>2</query-frame>
                      <hit-from>268</hit-from>
                      <hit-to>447</hit-to>
                      <hit-frame>1</hit-frame>
                      <align-len>60</align-len>
                      <gaps>0</gaps>
                      <qseq>GSKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE</qseq>
                      <hseq>GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE</hseq>
                      <midline>G KDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE</midline>
                    </Hsp>
                    <Hsp>
                      <num>2</num>
                      <bit-score>82.6285</bit-score>
                      <score>174</score>
                      <evalue>3.05617e-61</evalue>
                      <identity>33</identity>
                      <positive>33</positive>
                      <query-from>66</query-from>
                      <query-to>173</query-to>
                      <query-frame>3</query-frame>
                      <hit-from>169</hit-from>
                      <hit-to>276</hit-to>
                      <hit-frame>1</hit-frame>
                      <align-len>36</align-len>
                      <gaps>0</gaps>
                      <qseq>GCAKLGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK</qseq>
                      <hseq>GMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK</hseq>
                      <midline>G  K GFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK</midline>
                    </Hsp>
                    <Hsp>
                      <num>3</num>
                      <bit-score>48.721</bit-score>
                      <score>100</score>
                      <evalue>3.05617e-61</evalue>
                      <identity>19</identity>
                      <positive>20</positive>
                      <query-from>20</query-from>
                      <query-to>82</query-to>
                      <query-frame>2</query-frame>
                      <hit-from>124</hit-from>
                      <hit-to>186</hit-to>
                      <hit-frame>1</hit-frame>
                      <align-len>21</align-len>
                      <gaps>0</gaps>
                      <qseq>MADEEVQALVVDNGSGMCKAG</qseq>
                      <hseq>MADEEIAALVVDNGSGMCKAG</hseq>
                      <midline>MADEE+ ALVVDNGSGMCKAG</midline>
                    </Hsp>
                    <Hsp>
                      <num>4</num>
                      <bit-score>105.997</bit-score>
                      <score>225</score>
                      <evalue>1.43805e-40</evalue>
                      <identity>46</identity>
                      <positive>54</positive>
                      <query-from>163</query-from>
                      <query-to>354</query-to>
                      <query-frame>-3</query-frame>
                      <hit-from>267</hit-from>
                      <hit-to>458</hit-to>
                      <hit-frame>-2</hit-frame>
                      <align-len>64</align-len>
                      <gaps>0</gaps>
                      <qseq>IQWSSVNRTGCSSGATRNSL*NV*CQIFSMSSQFVTIPCSIGYFSVRIPRFDCASSPT*LSFDP</qseq>
                      <hseq>LRGASVSSTGCSSGATRSSL*KVWCQIFSMSSQLVTMPCSMGYLSVRMPLLLCASSPT*LSFCP</hseq>
                      <midline>++ +SV+ TGCSSGATR+SL* V CQIFSMSSQ VT+PCS+GY SVR+P   CASSPT*LSF P</midline>
                    </Hsp>
                    <Hsp>
                      <num>5</num>
                      <bit-score>68.424</bit-score>
                      <score>143</score>
                      <evalue>1.43805e-40</evalue>
                      <identity>27</identity>
                      <positive>30</positive>
                      <query-from>65</query-from>
                      <query-to>172</query-to>
                      <query-frame>-2</query-frame>
                      <hit-from>168</hit-from>
                      <hit-to>275</hit-to>
                      <hit-frame>-2</hit-frame>
                      <align-len>36</align-len>
                      <gaps>0</gaps>
                      <qseq>F*PIPTITP*CRGRPTMEGNTALGASSPANPSFAHP</qseq>
                      <hseq>FCPMPTMTPWCRGRPTMEGNTARGASSPANPALHMP</hseq>
                      <midline>F P+PT+TP CRGRPTMEGNTA GASSPANP+   P</midline>
                    </Hsp>
                    <Hsp>
                      <num>6</num>
                      <bit-score>39.0986</bit-score>
                      <score>79</score>
                      <evalue>1.43805e-40</evalue>
                      <identity>16</identity>
                      <positive>19</positive>
                      <query-from>19</query-from>
                      <query-to>81</query-to>
                      <query-frame>-3</query-frame>
                      <hit-from>123</hit-from>
                      <hit-to>185</hit-to>
                      <hit-frame>-2</hit-frame>
                      <align-len>21</align-len>
                      <gaps>0</gaps>
                      <qseq>PALHIPDPLSTTRA*TSSSAM</qseq>
                      <hseq>PALHMPEPLSTTRAAISSSAI</hseq>
                      <midline>PALH+P+PLSTTRA  SSSA+</midline>
                    </Hsp>
                    <Hsp>
                      <num>7</num>
                      <bit-score>67.5076</bit-score>
                      <score>141</score>
                      <evalue>3.58672e-08</evalue>
                      <identity>35</identity>
                      <positive>48</positive>
                      <query-from>21</query-from>
                      <query-to>341</query-to>
                      <query-frame>3</query-frame>
                      <hit-from>125</hit-from>
                      <hit-to>445</hit-to>
                      <hit-frame>2</hit-frame>
                      <align-len>107</align-len>
                      <gaps>0</gaps>
                      <qseq>WPTKKFKPSLLIMDQGCAKLGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKTATSVMKHNRNVVFSH*NTQSNTVL*RTGMTWRRSGITHSTMNCVWLQKNTLSC*P</qseq>
                      <hseq>WRTRRSLPWWWTTARACARRGSQGMTRPAPCSPPSWGGPGTRASWWAWGRRTATWGTRRRARGASSRSSTPSSTASSPTGTTWRRSGTTPSTTSCAWPPRSTRCCSP</hseq>
                      <midline>W T++  P      + CA+ G  G   P    P   G P  +      G++TAT   +       S  +T S+T    TG TWRRSG T ST +C W  ++T  C P</midline>
                    </Hsp>
                    <Hsp>
                      <num>8</num>
                      <bit-score>61.0927</bit-score>
                      <score>127</score>
                      <evalue>3.06042e-06</evalue>
                      <identity>27</identity>
                      <positive>35</positive>
                      <query-from>164</query-from>
                      <query-to>343</query-to>
                      <query-frame>-2</query-frame>
                      <hit-from>268</hit-from>
                      <hit-to>447</hit-to>
                      <hit-frame>-1</hit-frame>
                      <align-len>60</align-len>
                      <gaps>0</gaps>
                      <qseq>LGQQDRVFFWSHTQFIVECVMPDLLHVIPVRHNTVFDWVFQCENTTFRLCFITDVAVF*P</qseq>
                      <hseq>LGEQHRVLLGGHAQLVVEGVVPDLLHVVPVGDDAVLDGVLEREDAPLALRLVPHVAVLLP</hseq>
                      <midline>LG+Q RV    H Q +VE V+PDLLHV+PV  + V D V + E+    L  +  VAV  P</midline>
                    </Hsp>
                    <Hsp>
                      <num>9</num>
                      <bit-score>53.7613</bit-score>
                      <score>111</score>
                      <evalue>0.000492871</evalue>
                      <identity>22</identity>
                      <positive>30</positive>
                      <query-from>211</query-from>
                      <query-to>360</query-to>
                      <query-frame>1</query-frame>
                      <hit-from>315</hit-from>
                      <hit-to>464</hit-to>
                      <hit-frame>3</hit-frame>
                      <align-len>50</align-len>
                      <gaps>0</gaps>
                      <qseq>YSHTEIPNRTRYCDELG*HGEDLASHILQ*IACGSRRTPCPVDRAPLYPK</qseq>
                      <hseq>HPHAQVPHRARHRHQLGRHGEDLAPHLLQRAARGPRGAPGAAHRGPPQPQ</hseq>
                      <midline>+ H ++P+R R+  +LG HGEDLA H+LQ  A G R  P    R P  P+</midline>
                    </Hsp>
                    <Hsp>
                      <num>10</num>
                      <bit-score>43.2225</bit-score>
                      <score>88</score>
                      <evalue>0.733207</evalue>
                      <identity>20</identity>
                      <positive>22</positive>
                      <query-from>228</query-from>
                      <query-to>359</query-to>
                      <query-frame>-1</query-frame>
                      <hit-from>332</hit-from>
                      <hit-to>463</hit-to>
                      <hit-frame>-3</hit-frame>
                      <align-len>44</align-len>
                      <gaps>0</gaps>
                      <qseq>FGYNGARSTGQGVLLEPHAIHCRMCDARSSPCHPSSSQYRVRLG</qseq>
                      <hseq>WG*GGPR*AAPGAPRGPRAARCRRCGARSSPCRPSW*RCRARWG</hseq>
                      <midline>+G  G R    G    P A  CR C ARSSPC PS  + R R G</midline>
                    </Hsp>
                  </hsps>
                </Hit>
                <Hit>
                  <num>10</num>
                  <description>
                    <HitDescr>
                      <id>gi|1561775769|ref|XM_027888595.1|</id>
                      <accession>XM_027888595</accession>
                      <title>PREDICTED: Empidonax traillii actin, cytoplasmic type 5 (LOC114059764), transcript variant X2, mRNA</title>
                      <taxid>164674</taxid>
                      <sciname>Empidonax traillii</sciname>
                    </HitDescr>
                  </description>
                  <len>1596</len>
                  <hsps>
                    <Hsp>
                      <num>1</num>
                      <bit-score>151.818</bit-score>
                      <score>325</score>
                      <evalue>3.05624e-61</evalue>
                      <identity>59</identity>
                      <positive>59</positive>
                      <query-from>164</query-from>
                      <query-to>343</query-to>
                      <query-frame>2</query-frame>
                      <hit-from>265</hit-from>
                      <hit-to>444</hit-to>
                      <hit-frame>1</hit-frame>
                      <align-len>60</align-len>
                      <gaps>0</gaps>
                      <qseq>GSKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE</qseq>
                      <hseq>GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE</hseq>
                      <midline>G KDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE</midline>
                    </Hsp>
                    <Hsp>
                      <num>2</num>
                      <bit-score>82.6285</bit-score>
                      <score>174</score>
                      <evalue>3.05624e-61</evalue>
                      <identity>33</identity>
                      <positive>33</positive>
                      <query-from>66</query-from>
                      <query-to>173</query-to>
                      <query-frame>3</query-frame>
                      <hit-from>166</hit-from>
                      <hit-to>273</hit-to>
                      <hit-frame>1</hit-frame>
                      <align-len>36</align-len>
                      <gaps>0</gaps>
                      <qseq>GCAKLGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK</qseq>
                      <hseq>GMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK</hseq>
                      <midline>G  K GFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK</midline>
                    </Hsp>
                    <Hsp>
                      <num>3</num>
                      <bit-score>48.721</bit-score>
                      <score>100</score>
                      <evalue>3.05624e-61</evalue>
                      <identity>19</identity>
                      <positive>20</positive>
                      <query-from>20</query-from>
                      <query-to>82</query-to>
                      <query-frame>2</query-frame>
                      <hit-from>121</hit-from>
                      <hit-to>183</hit-to>
                      <hit-frame>1</hit-frame>
                      <align-len>21</align-len>
                      <gaps>0</gaps>
                      <qseq>MADEEVQALVVDNGSGMCKAG</qseq>
                      <hseq>MADEEIAALVVDNGSGMCKAG</hseq>
                      <midline>MADEE+ ALVVDNGSGMCKAG</midline>
                    </Hsp>
                    <Hsp>
                      <num>4</num>
                      <bit-score>105.997</bit-score>
                      <score>225</score>
                      <evalue>1.43809e-40</evalue>
                      <identity>46</identity>
                      <positive>54</positive>
                      <query-from>163</query-from>
                      <query-to>354</query-to>
                      <query-frame>-3</query-frame>
                      <hit-from>264</hit-from>
                      <hit-to>455</hit-to>
                      <hit-frame>-2</hit-frame>
                      <align-len>64</align-len>
                      <gaps>0</gaps>
                      <qseq>IQWSSVNRTGCSSGATRNSL*NV*CQIFSMSSQFVTIPCSIGYFSVRIPRFDCASSPT*LSFDP</qseq>
                      <hseq>LRGASVSSTGCSSGATRSSL*KVWCQIFSMSSQLVTMPCSMGYLSVRMPLLLCASSPT*LSFCP</hseq>
                      <midline>++ +SV+ TGCSSGATR+SL* V CQIFSMSSQ VT+PCS+GY SVR+P   CASSPT*LSF P</midline>
                    </Hsp>
                    <Hsp>
                      <num>5</num>
                      <bit-score>68.424</bit-score>
                      <score>143</score>
                      <evalue>1.43809e-40</evalue>
                      <identity>27</identity>
                      <positive>30</positive>
                      <query-from>65</query-from>
                      <query-to>172</query-to>
                      <query-frame>-2</query-frame>
                      <hit-from>165</hit-from>
                      <hit-to>272</hit-to>
                      <hit-frame>-2</hit-frame>
                      <align-len>36</align-len>
                      <gaps>0</gaps>
                      <qseq>F*PIPTITP*CRGRPTMEGNTALGASSPANPSFAHP</qseq>
                      <hseq>FCPMPTMTPWCRGRPTMEGNTARGASSPANPALHMP</hseq>
                      <midline>F P+PT+TP CRGRPTMEGNTA GASSPANP+   P</midline>
                    </Hsp>
                    <Hsp>
                      <num>6</num>
                      <bit-score>39.0986</bit-score>
                      <score>79</score>
                      <evalue>1.43809e-40</evalue>
                      <identity>16</identity>
                      <positive>19</positive>
                      <query-from>19</query-from>
                      <query-to>81</query-to>
                      <query-frame>-3</query-frame>
                      <hit-from>120</hit-from>
                      <hit-to>182</hit-to>
                      <hit-frame>-2</hit-frame>
                      <align-len>21</align-len>
                      <gaps>0</gaps>
                      <qseq>PALHIPDPLSTTRA*TSSSAM</qseq>
                      <hseq>PALHMPEPLSTTRAAISSSAI</hseq>
                      <midline>PALH+P+PLSTTRA  SSSA+</midline>
                    </Hsp>
                    <Hsp>
                      <num>7</num>
                      <bit-score>67.5076</bit-score>
                      <score>141</score>
                      <evalue>3.58672e-08</evalue>
                      <identity>35</identity>
                      <positive>48</positive>
                      <query-from>21</query-from>
                      <query-to>341</query-to>
                      <query-frame>3</query-frame>
                      <hit-from>122</hit-from>
                      <hit-to>442</hit-to>
                      <hit-frame>2</hit-frame>
                      <align-len>107</align-len>
                      <gaps>0</gaps>
                      <qseq>WPTKKFKPSLLIMDQGCAKLGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKTATSVMKHNRNVVFSH*NTQSNTVL*RTGMTWRRSGITHSTMNCVWLQKNTLSC*P</qseq>
                      <hseq>WRTRRSLPWWWTTARACARRGSQGMTRPAPCSPPSWGGPGTRASWWAWGRRTATWGTRRRARGASSRSSTPSSTASSPTGTTWRRSGTTPSTTSCAWPPRSTRCCSP</hseq>
                      <midline>W T++  P      + CA+ G  G   P    P   G P  +      G++TAT   +       S  +T S+T    TG TWRRSG T ST +C W  ++T  C P</midline>
                    </Hsp>
                    <Hsp>
                      <num>8</num>
                      <bit-score>61.0927</bit-score>
                      <score>127</score>
                      <evalue>3.06042e-06</evalue>
                      <identity>27</identity>
                      <positive>35</positive>
                      <query-from>164</query-from>
                      <query-to>343</query-to>
                      <query-frame>-2</query-frame>
                      <hit-from>265</hit-from>
                      <hit-to>444</hit-to>
                      <hit-frame>-1</hit-frame>
                      <align-len>60</align-len>
                      <gaps>0</gaps>
                      <qseq>LGQQDRVFFWSHTQFIVECVMPDLLHVIPVRHNTVFDWVFQCENTTFRLCFITDVAVF*P</qseq>
                      <hseq>LGEQHRVLLGGHAQLVVEGVVPDLLHVVPVGDDAVLDGVLEREDAPLALRLVPHVAVLLP</hseq>
                      <midline>LG+Q RV    H Q +VE V+PDLLHV+PV  + V D V + E+    L  +  VAV  P</midline>
                    </Hsp>
                    <Hsp>
                      <num>9</num>
                      <bit-score>53.7613</bit-score>
                      <score>111</score>
                      <evalue>0.000492871</evalue>
                      <identity>22</identity>
                      <positive>30</positive>
                      <query-from>211</query-from>
                      <query-to>360</query-to>
                      <query-frame>1</query-frame>
                      <hit-from>312</hit-from>
                      <hit-to>461</hit-to>
                      <hit-frame>3</hit-frame>
                      <align-len>50</align-len>
                      <gaps>0</gaps>
                      <qseq>YSHTEIPNRTRYCDELG*HGEDLASHILQ*IACGSRRTPCPVDRAPLYPK</qseq>
                      <hseq>HPHAQVPHRARHRHQLGRHGEDLAPHLLQRAARGPRGAPGAAHRGPPQPQ</hseq>
                      <midline>+ H ++P+R R+  +LG HGEDLA H+LQ  A G R  P    R P  P+</midline>
                    </Hsp>
                    <Hsp>
                      <num>10</num>
                      <bit-score>43.2225</bit-score>
                      <score>88</score>
                      <evalue>0.733207</evalue>
                      <identity>20</identity>
                      <positive>22</positive>
                      <query-from>228</query-from>
                      <query-to>359</query-to>
                      <query-frame>-1</query-frame>
                      <hit-from>329</hit-from>
                      <hit-to>460</hit-to>
                      <hit-frame>-3</hit-frame>
                      <align-len>44</align-len>
                      <gaps>0</gaps>
                      <qseq>FGYNGARSTGQGVLLEPHAIHCRMCDARSSPCHPSSSQYRVRLG</qseq>
                      <hseq>WG*GGPR*AAPGAPRGPRAARCRRCGARSSPCRPSW*RCRARWG</hseq>
                      <midline>+G  G R    G    P A  CR C ARSSPC PS  + R R G</midline>
                    </Hsp>
                  </hsps>
                </Hit>
              </hits>
              <stat>
                <Statistics>
                  <db-num>51302476</db-num>
                  <db-len>204305995260</db-len>
                  <hsp-len>63</hsp-len>
                  <eff-space>19590722614464</eff-space>
                  <kappa>-1</kappa>
                  <lambda>-1</lambda>
                  <entropy>-1</entropy>
                </Statistics>
              </stat>
            </Search>
          </search>
        </Results>
      </results>
    </Report>
  </report>
</BlastOutput2>
</BlastXML2>

