# hmmscan :: search sequence(s) against a profile database # HMMER 3.0 (March 2010); http://hmmer.org/ # Copyright (C) 2010 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: SWI-SNF.fa # target HMM database: /N/dc2/projects/marinovg/genomes/PFam/PFam27.0/Pfam-A.hmm # output directed to file: SWI-SNF.PFam-27-A # per-seq hits tabular output: SWI-SNF.tblout # number of worker threads: 16 # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: gi|73920185|sp|O14497.3|ARI1A_HUMAN [L=2285] Description: RecName: Full=AT-rich interactive domain-containing protein 1A; Short=ARID domain-containing protein 1A; AltName: Full=B120; AltName: Full=BRG1-associated factor 250; Short=BAF250; AltName: Full=BRG1-associated factor 250a; Short=BAF250A; AltName: Full=Osa homolog 1; Short=hOSA1; AltName: Full=SWI-like protein; AltName: Full=SWI/SNF complex protein p270; AltName: Full=SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1; AltName: Full=hELD Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-143 474.7 0.1 6.2e-143 474.1 0.1 1.3 1 DUF3518 Domain of unknown function (DUF3518) 1.3e-24 85.8 0.0 3.2e-24 84.5 0.0 1.7 1 ARID ARID/BRIGHT DNA binding domain Domain annotation for each model (and alignments): >> DUF3518 Domain of unknown function (DUF3518) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 474.1 0.1 8.4e-147 6.2e-143 1 257 [] 1975 2231 .. 1975 2231 .. 1.00 Alignments for each domain: == domain 1 score: 474.1 bits; conditional E-value: 8.4e-147 DUF3518 1 dslakrcicvsnilrslsfvPGndaelskhaglllilGkllllhhehaerkrakrtyereeeedkglacskd 72 dslakrc+cvsn++rslsfvPGnd+e+skh+glllilGkl+llhh+h+erk+a+ tye+eee+d+g++c+k gi|73920185|sp|O14497.3|ARI1A_HUMAN 1975 DSLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKV 2046 89********************************************************************** PP DUF3518 73 eWWWdclevlrenalvtlanisGqldlsaysesiclpvldGllhWlvcpsaeaqdPfptagpnsvlspqrlv 144 eWWWdcle+lren+lvtlanisGqldls y+esiclpvldGllhW+vcpsaeaqdPf+t+gpn+vlspqrlv gi|73920185|sp|O14497.3|ARI1A_HUMAN 2047 EWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLV 2118 ************************************************************************ PP DUF3518 145 lealcklsildanvdlilatppfsrleklfatlvrylgerknqvlrelavallsnlaqgdsaaaravalqkg 216 le+l+klsi+d+nvdlilatppfsrlekl++t+vr+l++rkn+v+re+av+ll+nlaqgds aara+a+qkg gi|73920185|sp|O14497.3|ARI1A_HUMAN 2119 LETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKG 2190 ************************************************************************ PP DUF3518 217 sigalvsfledavaaaqaqqsqhsllhmespdleptsvdml 257 sig+l++fled+ aa+q+qqsq+sllhm++p++eptsvdm+ gi|73920185|sp|O14497.3|ARI1A_HUMAN 2191 SIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMM 2231 ****************************************9 PP >> ARID ARID/BRIGHT DNA binding domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 84.5 0.0 4.4e-28 3.2e-24 4 92 .] 1017 1104 .. 1015 1104 .. 0.96 Alignments for each domain: == domain 1 score: 84.5 bits; conditional E-value: 4.4e-28 HCHHHHHHHHHHHHHHHCTSSSSC--EETTEE-SCHHHHHHHHHHCSHHHHHHCTCHHHHHHHHTS-SSCHH CS ARID 4 ekekeeflarlkkfmeergtplskiPviggkevdLyrLyelvqklGGlekVtkkkkWselaeklgipksats 75 e+e++ +++r+ +f ee+++ ++++P++g+k++dLyrLy v+++GGl +V+k+kkW+ela++l++ +s++ gi|73920185|sp|O14497.3|ARI1A_HUMAN 1017 EPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSA 1088 67999***************************************************************7777 PP HHHHHHHHHHHHTHHHH CS ARID 76 askelrsaYekyLlpye 92 a ++l+++Y+++L+++e gi|73920185|sp|O14497.3|ARI1A_HUMAN 1089 A-SSLKKQYIQCLYAFE 1104 7.**************8 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (2285 residues) Target model(s): 14831 (2610332 nodes) Passed MSV filter: 733 (0.0494235); expected 296.6 (0.02) Passed bias filter: 210 (0.0141595); expected 296.6 (0.02) Passed Vit filter: 83 (0.00559639); expected 14.8 (0.001) Passed Fwd filter: 21 (0.00141595); expected 0.1 (1e-05) Initial search space (Z): 14831 [actual number of targets] Domain search space (domZ): 2 [number of targets reported over threshold] # CPU time: 1.21u 0.20s 00:00:01.41 Elapsed: 00:00:00.55 # Mc/sec: 10844.74 // Query: gi|188536047|ref|NP_003065.3| [L=1105] Description: SWI/SNF complex subunit SMARCC1 [Homo sapiens] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-33 113.3 1.3 7.2e-33 112.5 0.0 2.1 2 SWIRM SWIRM domain 3e-09 36.7 0.2 7.6e-09 35.5 0.2 1.8 1 Myb_DNA-binding Myb-like DNA-binding domain 7e-08 32.4 0.0 2.4e-07 30.7 0.0 2.0 1 Myb_DNA-bind_6 Myb-like DNA-binding domain ------ inclusion threshold ------ 0.02 14.6 0.0 0.044 13.5 0.0 1.5 1 DUF2618 Protein of unknown function (DUF2618) Domain annotation for each model (and alignments): >> SWIRM SWIRM domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 112.5 0.0 1.9e-36 7.2e-33 2 86 .] 450 537 .. 449 537 .. 0.98 2 ? -2.0 0.1 1.1 4e+03 39 60 .. 932 953 .. 910 967 .. 0.56 Alignments for each domain: == domain 1 score: 112.5 bits; conditional E-value: 1.9e-36 XSSSSSTTTTTTTS-HHHHHHHHHCT-S....S-HHHHHHHHHHHHHHHHHHCCS---HHHHHHHCTSSSCHHHHHHHHH CS SWIRM 2 vipalsewfdldslheiEkellseifng....ktpeeYlkiRnkiieeyrenprkyltvtearrlikgidvslvskvhaf 77 ip++++wfd++ +h iE+++l+e+fng ktpe Yl +Rn++i++yr+np++ylt t++rr++ g dv++v++vhaf gi|188536047|ref|NP_003065.3| 450 IIPSYASWFDYNCIHVIERRALPEFFNGknksKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLTG-DVCAVMRVHAF 528 69*****************************************************************7.*********** PP HHHTTSSSS CS SWIRM 78 LekwGlInf 86 Le+wGl+n+ gi|188536047|ref|NP_003065.3| 529 LEQWGLVNY 537 ********8 PP == domain 2 score: -2.0 bits; conditional E-value: 1.1 HHHHHHHHHHHCCS---HHHHH CS SWIRM 39 Rnkiieeyrenprkyltvtear 60 R++++ e ++ +++l+ e r gi|188536047|ref|NP_003065.3| 932 RQQLLTERQNFHMEQLKYAELR 953 3444444444444444444433 PP >> Myb_DNA-binding Myb-like DNA-binding domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 35.5 0.2 2e-12 7.6e-09 3 46 .. 622 663 .. 620 665 .. 0.95 Alignments for each domain: == domain 1 score: 35.5 bits; conditional E-value: 2e-12 SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 WT++E +ll++a +++ + W+++++++g Rt +c+++++ gi|188536047|ref|NP_003065.3| 622 EWTEQETLLLLEALEMYKDD-WNKVSEHVG-SRTQDECILHFLR 663 6*****************88.*********.**********986 PP >> Myb_DNA-bind_6 Myb-like DNA-binding domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.7 0.0 6.6e-11 2.4e-07 1 44 [. 623 665 .. 623 703 .. 0.87 Alignments for each domain: == domain 1 score: 30.7 bits; conditional E-value: 6.6e-11 Myb_DNA-bind_6 1 WtdeEdeiLlklveeygndWseIaeelgrRtplacqdrwknkLr 44 Wt++E+ Ll+ e y +dW++++e+ g+Rt+++c ++++ L+ gi|188536047|ref|NP_003065.3| 623 WTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLR-LP 665 ***************************99***********9.84 PP >> DUF2618 Protein of unknown function (DUF2618) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 13.5 0.0 1.2e-05 0.044 12 27 .. 446 461 .. 444 465 .. 0.91 Alignments for each domain: == domain 1 score: 13.5 bits; conditional E-value: 1.2e-05 DUF2618 12 TRHIMMPSyRscFsYS 27 T HI++PSy s F+Y gi|188536047|ref|NP_003065.3| 446 TNHIIIPSYASWFDYN 461 99*************5 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1105 residues) Target model(s): 14831 (2610332 nodes) Passed MSV filter: 1669 (0.112535); expected 296.6 (0.02) Passed bias filter: 306 (0.0206325); expected 296.6 (0.02) Passed Vit filter: 61 (0.00411301); expected 14.8 (0.001) Passed Fwd filter: 14 (0.000943969); expected 0.1 (1e-05) Initial search space (Z): 14831 [actual number of targets] Domain search space (domZ): 4 [number of targets reported over threshold] # CPU time: 0.62u 0.21s 00:00:00.83 Elapsed: 00:00:00.35 # Mc/sec: 8241.19 // Query: gi|194363725|ref|NP_001123892.1| [L=1152] Description: SWI/SNF complex subunit SMARCC2 isoform c [Homo sapiens] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-35 121.3 0.7 2.7e-35 120.3 0.0 1.9 2 SWIRM SWIRM domain 2.8e-09 36.8 0.3 7.3e-09 35.5 0.2 1.8 1 Myb_DNA-binding Myb-like DNA-binding domain 1.1e-07 31.8 0.0 2.7e-07 30.5 0.0 1.7 1 Myb_DNA-bind_6 Myb-like DNA-binding domain 0.0029 17.2 0.6 0.009 15.6 0.4 1.8 1 Chromo Chromo (CHRromatin Organisation MOdifier) do ------ inclusion threshold ------ 0.11 12.3 0.0 0.24 11.1 0.0 1.5 1 DUF2618 Protein of unknown function (DUF2618) Domain annotation for each model (and alignments): >> SWIRM SWIRM domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 120.3 0.0 9.1e-39 2.7e-35 2 86 .] 425 512 .. 424 512 .. 0.98 2 ? -2.9 0.1 2.6 7.6e+03 8 28 .. 963 983 .. 940 990 .. 0.65 Alignments for each domain: == domain 1 score: 120.3 bits; conditional E-value: 9.1e-39 XSSSSSTTTTTTTS-HHHHHHHHHCT-S....S-HHHHHHHHHHHHHHHHHHCCS---HHHHHHHCTSSSCHHHHHH CS SWIRM 2 vipalsewfdldslheiEkellseifng....ktpeeYlkiRnkiieeyrenprkyltvtearrlikgidvslvskv 74 ip++++wfd++s+h iE+++l+e+fng ktpe Yl +Rn++i++yr+np++ylt t++rr+++g dv+++++v gi|194363725|ref|NP_001123892.1| 425 IIPSYAAWFDYNSVHAIERRALPEFFNGknksKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAG-DVCAIMRV 500 69*****************************************************************7.******** PP HHHHHHTTSSSS CS SWIRM 75 hafLekwGlInf 86 hafLe+wGlIn+ gi|194363725|ref|NP_001123892.1| 501 HAFLEQWGLINY 512 ***********8 PP == domain 2 score: -2.9 bits; conditional E-value: 2.6 TTTTTTTS-HHHHHHHHHCT- CS SWIRM 8 ewfdldslheiEkellseifn 28 + f++++l+ E ++ ++ f+ gi|194363725|ref|NP_001123892.1| 963 QAFHMEQLKYAEMRARQQHFQ 983 456666666666655555555 PP >> Myb_DNA-binding Myb-like DNA-binding domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 35.5 0.2 2.5e-12 7.3e-09 3 46 .. 631 672 .. 629 674 .. 0.94 Alignments for each domain: == domain 1 score: 35.5 bits; conditional E-value: 2.5e-12 SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 WT++E +ll++a +++ + W+++++++g Rt +c+++++ gi|194363725|ref|NP_001123892.1| 631 EWTEQETLLLLEALEMYKDD-WNKVSEHVG-SRTQDECILHFLR 672 7*****************88.*********.**********986 PP >> Myb_DNA-bind_6 Myb-like DNA-binding domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.5 0.0 9e-11 2.7e-07 1 44 [. 632 674 .. 632 713 .. 0.86 Alignments for each domain: == domain 1 score: 30.5 bits; conditional E-value: 9e-11 Myb_DNA-bind_6 1 WtdeEdeiLlklveeygndWseIaeelgrRtplacqdrwknkLr 44 Wt++E+ Ll+ e y +dW++++e+ g+Rt+++c ++++ L+ gi|194363725|ref|NP_001123892.1| 632 WTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLR-LP 674 ***************************99***********9.84 PP >> Chromo Chromo (CHRromatin Organisation MOdifier) domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 15.6 0.4 3e-06 0.009 14 44 .. 196 224 .. 187 228 .. 0.83 Alignments for each domain: == domain 1 score: 15.6 bits; conditional E-value: 3e-06 TEECCEEEEEEETTSTGGGSEEEEGGGCSSH CS Chromo 14 kgkgvpeyLVKWkglpyeecTWEpeenlkkc 44 k+ +++L +W +p++++TW p++++++ gi|194363725|ref|NP_001123892.1| 196 KRD--KQVLLHWGYYPDSYDTWIPASEIEAS 224 333..5*********************9875 PP >> DUF2618 Protein of unknown function (DUF2618) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 11.1 0.0 8.1e-05 0.24 12 26 .. 421 435 .. 419 441 .. 0.90 Alignments for each domain: == domain 1 score: 11.1 bits; conditional E-value: 8.1e-05 DUF2618 12 TRHIMMPSyRscFsY 26 T HI++PSy F+Y gi|194363725|ref|NP_001123892.1| 421 THHIIIPSYAAWFDY 435 99************* PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1152 residues) Target model(s): 14831 (2610332 nodes) Passed MSV filter: 1086 (0.073225); expected 296.6 (0.02) Passed bias filter: 226 (0.0152384); expected 296.6 (0.02) Passed Vit filter: 30 (0.00202279); expected 14.8 (0.001) Passed Fwd filter: 7 (0.000471984); expected 0.1 (1e-05) Initial search space (Z): 14831 [actual number of targets] Domain search space (domZ): 5 [number of targets reported over threshold] # CPU time: 0.50u 0.19s 00:00:00.69 Elapsed: 00:00:00.24 # Mc/sec: 12529.59 // Query: gi|21237808|ref|NP_620706.1| [L=1130] Description: SWI/SNF complex subunit SMARCC2 isoform b [Homo sapiens] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-35 121.4 0.7 2.6e-35 120.3 0.0 1.9 2 SWIRM SWIRM domain 2.7e-09 36.9 0.3 7.2e-09 35.5 0.2 1.8 1 Myb_DNA-binding Myb-like DNA-binding domain 1.1e-07 31.8 0.0 2.6e-07 30.6 0.0 1.7 1 Myb_DNA-bind_6 Myb-like DNA-binding domain 0.0028 17.2 0.6 0.0088 15.6 0.4 1.8 1 Chromo Chromo (CHRromatin Organisation MOdifier) do ------ inclusion threshold ------ 0.1 12.3 0.0 0.24 11.2 0.0 1.5 1 DUF2618 Protein of unknown function (DUF2618) Domain annotation for each model (and alignments): >> SWIRM SWIRM domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 120.3 0.0 8.8e-39 2.6e-35 2 86 .] 425 512 .. 424 512 .. 0.98 2 ? -2.9 0.1 2.5 7.4e+03 8 28 .. 963 983 .. 940 990 .. 0.65 Alignments for each domain: == domain 1 score: 120.3 bits; conditional E-value: 8.8e-39 XSSSSSTTTTTTTS-HHHHHHHHHCT-S....S-HHHHHHHHHHHHHHHHHHCCS---HHHHHHHCTSSSCHHHHHHHHHH CS SWIRM 2 vipalsewfdldslheiEkellseifng....ktpeeYlkiRnkiieeyrenprkyltvtearrlikgidvslvskvhafL 78 ip++++wfd++s+h iE+++l+e+fng ktpe Yl +Rn++i++yr+np++ylt t++rr+++g dv+++++vhafL gi|21237808|ref|NP_620706.1| 425 IIPSYAAWFDYNSVHAIERRALPEFFNGknksKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAG-DVCAIMRVHAFL 504 69*****************************************************************7.************ PP HHTTSSSS CS SWIRM 79 ekwGlInf 86 e+wGlIn+ gi|21237808|ref|NP_620706.1| 505 EQWGLINY 512 *******8 PP == domain 2 score: -2.9 bits; conditional E-value: 2.5 TTTTTTTS-HHHHHHHHHCT- CS SWIRM 8 ewfdldslheiEkellseifn 28 + f++++l+ E ++ ++ f+ gi|21237808|ref|NP_620706.1| 963 QAFHMEQLKYAEMRARQQHFQ 983 456666666666655555555 PP >> Myb_DNA-binding Myb-like DNA-binding domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 35.5 0.2 2.4e-12 7.2e-09 3 46 .. 631 672 .. 629 674 .. 0.94 Alignments for each domain: == domain 1 score: 35.5 bits; conditional E-value: 2.4e-12 SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 WT++E +ll++a +++ + W+++++++g Rt +c+++++ gi|21237808|ref|NP_620706.1| 631 EWTEQETLLLLEALEMYKDD-WNKVSEHVG-SRTQDECILHFLR 672 7*****************88.*********.**********986 PP >> Myb_DNA-bind_6 Myb-like DNA-binding domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.6 0.0 8.8e-11 2.6e-07 1 44 [. 632 674 .. 632 713 .. 0.86 Alignments for each domain: == domain 1 score: 30.6 bits; conditional E-value: 8.8e-11 Myb_DNA-bind_6 1 WtdeEdeiLlklveeygndWseIaeelgrRtplacqdrwknkLr 44 Wt++E+ Ll+ e y +dW++++e+ g+Rt+++c ++++ L+ gi|21237808|ref|NP_620706.1| 632 WTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLR-LP 674 ***************************99***********9.84 PP >> Chromo Chromo (CHRromatin Organisation MOdifier) domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 15.6 0.4 3e-06 0.0088 14 44 .. 196 224 .. 187 228 .. 0.83 Alignments for each domain: == domain 1 score: 15.6 bits; conditional E-value: 3e-06 TEECCEEEEEEETTSTGGGSEEEEGGGCSSH CS Chromo 14 kgkgvpeyLVKWkglpyeecTWEpeenlkkc 44 k+ +++L +W +p++++TW p++++++ gi|21237808|ref|NP_620706.1| 196 KRD--KQVLLHWGYYPDSYDTWIPASEIEAS 224 333..5*********************9875 PP >> DUF2618 Protein of unknown function (DUF2618) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 11.2 0.0 8e-05 0.24 12 26 .. 421 435 .. 419 441 .. 0.90 Alignments for each domain: == domain 1 score: 11.2 bits; conditional E-value: 8e-05 DUF2618 12 TRHIMMPSyRscFsY 26 T HI++PSy F+Y gi|21237808|ref|NP_620706.1| 421 THHIIIPSYAAWFDY 435 99************* PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1130 residues) Target model(s): 14831 (2610332 nodes) Passed MSV filter: 1068 (0.0720113); expected 296.6 (0.02) Passed bias filter: 221 (0.0149012); expected 296.6 (0.02) Passed Vit filter: 31 (0.00209022); expected 14.8 (0.001) Passed Fwd filter: 7 (0.000471984); expected 0.1 (1e-05) Initial search space (Z): 14831 [actual number of targets] Domain search space (domZ): 5 [number of targets reported over threshold] # CPU time: 0.50u 0.20s 00:00:00.70 Elapsed: 00:00:00.25 # Mc/sec: 11798.70 // Query: gi|21237805|ref|NP_003066.2| [L=1214] Description: SWI/SNF complex subunit SMARCC2 isoform a [Homo sapiens] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-35 121.1 0.7 2.9e-35 120.2 0.0 1.9 2 SWIRM SWIRM domain 3.1e-09 36.7 0.3 7.8e-09 35.4 0.2 1.8 1 Myb_DNA-binding Myb-like DNA-binding domain 1.2e-07 31.7 0.0 2.8e-07 30.5 0.0 1.7 1 Myb_DNA-bind_6 Myb-like DNA-binding domain 0.0032 17.0 0.6 0.0096 15.5 0.4 1.7 1 Chromo Chromo (CHRromatin Organisation MOdifier) do ------ inclusion threshold ------ 0.11 12.2 0.0 0.26 11.1 0.0 1.5 1 DUF2618 Protein of unknown function (DUF2618) Domain annotation for each model (and alignments): >> SWIRM SWIRM domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 120.2 0.0 9.7e-39 2.9e-35 2 86 .] 425 512 .. 424 512 .. 0.98 2 ? -3.1 0.1 2.8 8.4e+03 8 28 .. 932 952 .. 910 959 .. 0.67 Alignments for each domain: == domain 1 score: 120.2 bits; conditional E-value: 9.7e-39 XSSSSSTTTTTTTS-HHHHHHHHHCT-S....S-HHHHHHHHHHHHHHHHHHCCS---HHHHHHHCTSSSCHHHHHHHHHH CS SWIRM 2 vipalsewfdldslheiEkellseifng....ktpeeYlkiRnkiieeyrenprkyltvtearrlikgidvslvskvhafL 78 ip++++wfd++s+h iE+++l+e+fng ktpe Yl +Rn++i++yr+np++ylt t++rr+++g dv+++++vhafL gi|21237805|ref|NP_003066.2| 425 IIPSYAAWFDYNSVHAIERRALPEFFNGknksKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAG-DVCAIMRVHAFL 504 69*****************************************************************7.************ PP HHTTSSSS CS SWIRM 79 ekwGlInf 86 e+wGlIn+ gi|21237805|ref|NP_003066.2| 505 EQWGLINY 512 *******8 PP == domain 2 score: -3.1 bits; conditional E-value: 2.8 TTTTTTTS-HHHHHHHHHCT- CS SWIRM 8 ewfdldslheiEkellseifn 28 + f++++l+ E ++ ++ f+ gi|21237805|ref|NP_003066.2| 932 QAFHMEQLKYAEMRARQQHFQ 952 556666666666666555555 PP >> Myb_DNA-binding Myb-like DNA-binding domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 35.4 0.2 2.6e-12 7.8e-09 3 46 .. 600 641 .. 598 643 .. 0.94 Alignments for each domain: == domain 1 score: 35.4 bits; conditional E-value: 2.6e-12 SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 WT++E +ll++a +++ + W+++++++g Rt +c+++++ gi|21237805|ref|NP_003066.2| 600 EWTEQETLLLLEALEMYKDD-WNKVSEHVG-SRTQDECILHFLR 641 7*****************88.*********.**********986 PP >> Myb_DNA-bind_6 Myb-like DNA-binding domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.5 0.0 9.6e-11 2.8e-07 1 44 [. 601 643 .. 601 682 .. 0.86 Alignments for each domain: == domain 1 score: 30.5 bits; conditional E-value: 9.6e-11 Myb_DNA-bind_6 1 WtdeEdeiLlklveeygndWseIaeelgrRtplacqdrwknkLr 44 Wt++E+ Ll+ e y +dW++++e+ g+Rt+++c ++++ L+ gi|21237805|ref|NP_003066.2| 601 WTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLR-LP 643 ***************************99***********9.84 PP >> Chromo Chromo (CHRromatin Organisation MOdifier) domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 15.5 0.4 3.2e-06 0.0096 14 44 .. 196 224 .. 187 228 .. 0.83 Alignments for each domain: == domain 1 score: 15.5 bits; conditional E-value: 3.2e-06 TEECCEEEEEEETTSTGGGSEEEEGGGCSSH CS Chromo 14 kgkgvpeyLVKWkglpyeecTWEpeenlkkc 44 k+ +++L +W +p++++TW p++++++ gi|21237805|ref|NP_003066.2| 196 KRD--KQVLLHWGYYPDSYDTWIPASEIEAS 224 333..5*********************9875 PP >> DUF2618 Protein of unknown function (DUF2618) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 11.1 0.0 8.6e-05 0.26 12 26 .. 421 435 .. 419 441 .. 0.90 Alignments for each domain: == domain 1 score: 11.1 bits; conditional E-value: 8.6e-05 DUF2618 12 TRHIMMPSyRscFsY 26 T HI++PSy F+Y gi|21237805|ref|NP_003066.2| 421 THHIIIPSYAAWFDY 435 99************* PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1214 residues) Target model(s): 14831 (2610332 nodes) Passed MSV filter: 1125 (0.0758546); expected 296.6 (0.02) Passed bias filter: 249 (0.0167892); expected 296.6 (0.02) Passed Vit filter: 35 (0.00235992); expected 14.8 (0.001) Passed Fwd filter: 7 (0.000471984); expected 0.1 (1e-05) Initial search space (Z): 14831 [actual number of targets] Domain search space (domZ): 5 [number of targets reported over threshold] # CPU time: 0.59u 0.27s 00:00:00.86 Elapsed: 00:00:00.26 # Mc/sec: 12188.24 // Query: gi|223460528|gb|AAI36645.1| [L=1681] Description: SMARCA4 protein [Homo sapiens] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-79 266.5 0.4 2e-79 266.5 0.3 2.3 2 SNF2_N SNF2 family N-terminal domain 4.3e-23 81.0 0.3 2.6e-22 78.5 0.2 2.4 2 Bromodomain Bromodomain 3.3e-19 68.8 7.3 3.3e-19 68.8 5.0 7.8 8 SnAC Snf2-ATP coupling, chromatin remodelling complex 2.3e-18 65.3 0.0 4.6e-18 64.4 0.0 1.5 1 BRK BRK domain 4.8e-18 64.7 14.4 4.8e-18 64.7 10.0 5.1 5 HSA HSA 5.3e-16 58.2 0.0 5.5e-15 54.9 0.0 2.7 3 Helicase_C Helicase conserved C-terminal domain 1.8e-15 56.0 2.8 4.8e-15 54.6 2.0 1.8 1 QLQ QLQ ------ inclusion threshold ------ 0.056 13.7 3.0 9.6 6.6 0.2 3.0 2 DUF4144 protein structure with unknown function Domain annotation for each model (and alignments): >> SNF2_N SNF2 family N-terminal domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -7.9 5.4 8 1.5e+04 212 266 .. 492 547 .. 412 643 .. 0.62 2 ! 266.5 0.3 1.1e-82 2e-79 1 298 [. 821 1115 .. 821 1116 .. 0.93 Alignments for each domain: == domain 1 score: -7.9 bits; conditional E-value: 8 HHCCCCCCCCGCCCCCHCGGGC.TTTSTHCCCCCCCCGG-CCCCCCCHHHHHH... CS xxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF SNF2_N 212 egrsrLlkllkplmlrrakkdv.eknlPpkteeiiflklseverklYnklltksra 266 +++kl k + +a+++ +k+ +++e+ + +l ++ ++ Y+kl+++++ gi|223460528|gb|AAI36645.1| 492 SVTGKIQKLTKAVATYHANTEReQKKENERIEKERMRRLMAEDEEGYRKLIDQKKD 547 33334444444444444444444444444555555555555555555544443333 PP == domain 2 score: 266.5 bits; conditional E-value: 1.1e-82 HHHHHHHHHHHCC.........TTT-EEEE---TTSSCCHHHHHHHHHHCCCHS-.....EEEE--TTTHHHHHHHHHHC CS xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF SNF2_N 1 yQkeavawmlkrelaaesapaeqsvrggiLaDemGlGKTvqvialilllkeeaerkkkkstLivvPsslldqWvneierh 80 yQ+++++w+++++ +++ +giLaDemGlGKT+q+iali++l+e+++ ++ +Li+vP s+l +W e++++ gi|223460528|gb|AAI36645.1| 821 YQIKGLEWLVSLY---------NNNLNGILADEMGLGKTIQTIALITYLMEHKRING--PFLIIVPLSTLSNWAYEFDKW 889 9************.........9****************************999975..7******************** PP S.T.T--EEE--HCCCHHHTT..-SSSTT-SEEEE-CCHHH..TSTCTCHHHHTSEEEEEEETTCCGGTTCSSHHHHHHC CS xxxxxxxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF SNF2_N 81 vspsalrvlvyggqkkakksa..aklladydvvittydvlralrekkrksvlkkvkwkrvvlDEahrlknstskaaeall 158 + p ++ + y+g+ +a++ + + + +++v++tty+++ k+k l k++wk++++DE+hr+kn+++k+++ l+ gi|223460528|gb|AAI36645.1| 890 A-P-SVVKVSYKGSPAARRAFvpQLRSGKFNVLLTTYEYII-----KDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLN 962 *.5.577788999986655550055556899**********.....********************************** PP C.CCECCEEEC-SS-SSS-SCHCHHHHHHH-TTT-S...STHHHHHHH..........STTHHHHHCCCCCCCCGCCCCC CS x.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..........xxxxxxxxxxxxxxxxxxxxxx RF SNF2_N 159 k.lstknrwiltGTPiqnkleelyallkFlrpepltnkrsfdqliqrp..........eeakseegrsrLlkllkplmlr 227 + + +r++ltGTP+qnkl el+all+Fl p ++++ ++f+q+++ p +e+++ ++rL+k+l+p++lr gi|223460528|gb|AAI36645.1| 963 ThYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPfamtgekvdlNEEETILIIRRLHKVLRPFLLR 1042 *888****************************************************99999999**************** PP HCGGGCTTTSTHCCCCCCCCGG-CCCCCCCHHHHHH...................THCCCHHHHHHHHH-CCC CS xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxx RF SNF2_N 228 rakkdveknlPpkteeiiflklseverklYnklltksravlklsv..aeesgklasileellelrkicnhpel 298 r kk+ve +lP+k+e++i++++s+ +r lY+++ k + + s ++ +g ++ +++ +++lrkicnhp++ gi|223460528|gb|AAI36645.1| 1043 RLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEkdKKGKGGTKTLMNTIMQLRKICNHPYM 1115 *******************************777777777776667778888999****************87 PP >> Bromodomain Bromodomain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.4 0.0 5.1 9.4e+03 24 44 .. 1405 1425 .. 1395 1436 .. 0.77 2 ! 78.5 0.2 1.4e-25 2.6e-22 9 82 .. 1511 1584 .. 1496 1585 .. 0.93 Alignments for each domain: == domain 1 score: -3.4 bits; conditional E-value: 5.1 CCSTTHHHH-SS---HHHHHH CS Bromodomain 24 keapdYydiikrPidLktIqk 44 ++ dY+d +++ Lkt+++ gi|223460528|gb|AAI36645.1| 1405 RKEVDYSDSLTEKQWLKTLKA 1425 566799999999999999976 PP == domain 2 score: 78.5 bits; conditional E-value: 1.4e-25 HTTTCGGGGCSTT-GCCSTTHHHH-SS---HHHHHHHHHTT--SSHHHHHHHHHHHHHHHHHHSHTTSHHHHHH CS Bromodomain 9 qehklastFsapvdakeapdYydiikrPidLktIqkklasgkyqslaqfekdlelvfsNavkyneegsdvyeda 82 ++l++ F++ +++ke+p+Yy++i++P+d+k I+++++++ky+sl ++ekd++l+++Na+++n egs +yed+ gi|223460528|gb|AAI36645.1| 1511 SGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDS 1584 557799*****************************************************************985 PP >> SnAC Snf2-ATP coupling, chromatin remodelling complex # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.8 3.1 8 1.5e+04 33 61 .. 442 470 .. 436 477 .. 0.63 2 ? -1.0 4.6 1.1 2e+03 2 25 .. 512 535 .. 511 573 .. 0.76 3 ? -3.2 5.2 5.3 9.8e+03 2 25 .. 579 599 .. 569 659 .. 0.76 4 ? -4.0 1.3 8 1.5e+04 39 47 .. 727 735 .. 717 742 .. 0.44 5 ! 68.8 5.0 1.8e-22 3.3e-19 2 74 .] 1353 1420 .. 1352 1420 .. 0.90 6 ? -3.1 0.9 4.7 8.6e+03 38 61 .. 1431 1449 .. 1423 1451 .. 0.50 7 ? -3.2 0.0 5.1 9.5e+03 22 37 .. 1524 1539 .. 1521 1552 .. 0.68 8 ? -6.0 5.8 8 1.5e+04 42 72 .. 1640 1670 .. 1593 1671 .. 0.71 Alignments for each domain: == domain 1 score: -4.8 bits; conditional E-value: 8 SnAC 33 deeevlekeeeegelevkeygrgkReRke 61 + + l++++ ++le ++ + R+R++ gi|223460528|gb|AAI36645.1| 442 SKRQSLREARITEKLEKQQKIEQERKRRQ 470 55555566666666666777777777765 PP == domain 2 score: -1.0 bits; conditional E-value: 1.1 SnAC 2 eRrreeany.gekkplpsRLitedE 25 eR+++++n+ +ek++++ RL+ edE gi|223460528|gb|AAI36645.1| 512 EREQKKENErIEKERMR-RLMAEDE 535 67777776635889999.******9 PP == domain 3 score: -3.2 bits; conditional E-value: 5.3 SnAC 2 eRrreeanygekkplpsRLitedE 25 e++++e+ +ek++++ RL+ edE gi|223460528|gb|AAI36645.1| 579 EKKENER--IEKERMR-RLMAEDE 599 4444444..5888899.******9 PP == domain 4 score: -4.0 bits; conditional E-value: 8 SnAC 39 ekeeeegel 47 e+eeee+e+ gi|223460528|gb|AAI36645.1| 727 EEEEEEEEE 735 222222222 PP == domain 5 score: 68.8 bits; conditional E-value: 1.8e-22 SnAC 2 eRrreeanygekkplpsRLitedELPewikedeeev..lekeeeegelevkeygrgkReRkevsYdDgltEeqwl 74 +Rrreea++ +k++p RL++edELP+wi +d+ ev l+ eeee++ grg+R Rkev+Y+D+ltE+qwl gi|223460528|gb|AAI36645.1| 1353 DRRREEARN--PKRKP-RLMEEDELPSWIIKDDAEVerLTCEEEEEKMF----GRGSRHRKEVDYSDSLTEKQWL 1420 699999955..77777.*******************9988888888776....*********************8 PP == domain 6 score: -3.1 bits; conditional E-value: 4.7 SnAC 38 lekeeeegelevkeygrgkReRke 61 le+ eee ++ + +R+Rk+ gi|223460528|gb|AAI36645.1| 1431 LEEIEEEVRQ-----KKSSRKRKR 1449 4444444444.....344566654 PP == domain 7 score: -3.2 bits; conditional E-value: 5.1 SnAC 22 tedELPewikedeeev 37 + +ELPe ++ ++v gi|223460528|gb|AAI36645.1| 1524 SRKELPEYYELIRKPV 1539 5789**9998666665 PP == domain 8 score: -6.0 bits; conditional E-value: 8 SnAC 42 eeegelevkeygrgkReRkevsYdDgltEeq 72 ++ + rg+R++ +vs dD+ +E++ gi|223460528|gb|AAI36645.1| 1640 QDRLKGGRRRPSRGSRAKPVVSDDDSEEEQE 1670 3333333345688999999999888888765 PP >> BRK BRK domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 64.4 0.0 2.5e-21 4.6e-18 1 46 [] 674 719 .. 674 719 .. 0.97 Alignments for each domain: == domain 1 score: 64.4 bits; conditional E-value: 2.5e-21 BRK 1 sltgeeRVpVinrkdGkrLtGdeAPklkdLeeWLqenPgYevdPrs 46 s++++ +V+Vi+ ++Gk LtG +APk+ +Le+WL++nPgYev+Prs gi|223460528|gb|AAI36645.1| 674 SQMSDLPVKVIHVESGKILTGTDAPKAGQLEAWLEMNPGYEVAPRS 719 6899****************************************96 PP >> HSA HSA # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 64.7 10.0 2.6e-21 4.8e-18 1 73 [] 460 532 .. 460 532 .. 0.98 2 ! 5.5 2.9 0.0075 14 44 73 .] 567 596 .. 561 596 .. 0.87 3 ? -3.0 2.8 3.3 6.2e+03 48 68 .. 634 654 .. 627 657 .. 0.59 4 ? -4.7 1.6 8 1.5e+04 54 68 .. 1435 1448 .. 1424 1450 .. 0.56 5 ? -2.7 0.0 2.6 4.9e+03 36 48 .. 1494 1506 .. 1493 1511 .. 0.88 Alignments for each domain: == domain 1 score: 64.7 bits; conditional E-value: 2.6e-21 HSA 1 qrleeeqrekthwdhlLeemkwmakdFreerkwkiaaakklaravaqyhketeeeeqrrkereekerlkalaa 73 q++e+e++++++++++L++++++akdF+e++++ + +kl +ava yh++te+e++++ er+eker+++l+a gi|223460528|gb|AAI36645.1| 460 QKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMA 532 89********************************************************************985 PP == domain 2 score: 5.5 bits; conditional E-value: 0.0075 HSA 44 avaqyhketeeeeqrrkereekerlkalaa 73 v q+ +++ +e+++ er+eker+++l+a gi|223460528|gb|AAI36645.1| 567 LVRQHKAAQVAKEKKENERIEKERMRRLMA 596 588999999999999999*********985 PP == domain 3 score: -3.0 bits; conditional E-value: 3.3 HSA 48 yhketeeeeqrrkereekerl 68 hk+ + +++++k++ +k+ + gi|223460528|gb|AAI36645.1| 634 QHKAAQVAKEKKKKKKKKKAE 654 456666666666664555544 PP == domain 4 score: -4.7 bits; conditional E-value: 8 HSA 54 eeeqrrkereekerl 68 eee r+k+ ++r+ gi|223460528|gb|AAI36645.1| 1435 EEEVRQKK-SSRKRK 1448 34444444.444444 PP == domain 5 score: -2.7 bits; conditional E-value: 2.6 HSA 36 aaakklaravaqy 48 ++kk+++av +y gi|223460528|gb|AAI36645.1| 1494 KKMKKIVDAVIKY 1506 589*******999 PP >> Helicase_C Helicase conserved C-terminal domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.0 0.0 0.84 1.6e+03 19 40 .. 902 923 .. 892 924 .. 0.83 2 ? -3.5 0.0 5.1 9.5e+03 51 62 .. 1055 1066 .. 1054 1075 .. 0.77 3 ! 54.9 0.0 3e-18 5.5e-15 4 78 .] 1181 1258 .. 1178 1258 .. 0.96 Alignments for each domain: == domain 1 score: -1.0 bits; conditional E-value: 0.84 HHHHHHHHHHHHTTSSSEEEES CS Helicase_C 19 qnereeileqfnagkskvlvat 40 + r++ + q ++gk++vl++t gi|223460528|gb|AAI36645.1| 902 PAARRAFVPQLRSGKFNVLLTT 923 6678888999**********98 PP == domain 2 score: -3.5 bits; conditional E-value: 5.1 TEEEEEESSSSS CS Helicase_C 51 dvnvVinfdlpr 62 +v++Vi +d++ gi|223460528|gb|AAI36645.1| 1055 KVEYVIKCDMSA 1066 799******975 PP == domain 3 score: 54.9 bits; conditional E-value: 3e-18 HHTTS-EEEESTTSTHHHHHHHHHHHHTTSS...SEEEESGGGTSSSTSTTEEEEEESSSSSSHHHHHHHHTTSSTTT CS Helicase_C 4 ekkgikvailhgelpqnereeileqfnagks...kvlvatnvaerGidlpdvnvVinfdlprsvtsyiQriGRtgRag 78 +g+k+++l+g +++++r l+ fn+ s +l++t++++ G++l+++++Vi+fd ++++ + +Q+ +R++R+g gi|223460528|gb|AAI36645.1| 1181 AYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSeyfIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIG 1258 6789************************999999******************************************87 PP >> QLQ QLQ # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 54.6 2.0 2.6e-18 4.8e-15 2 37 .] 171 206 .. 170 206 .. 0.96 Alignments for each domain: == domain 1 score: 54.6 bits; conditional E-value: 2.6e-18 QLQ 2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 +F+ +Ql++L++Qi+AyK+La++qP+P +L++a+q+ gi|223460528|gb|AAI36645.1| 171 PFNQNQLHQLRAQIMAYKMLARGQPLPDHLQMAVQG 206 9********************************995 PP >> DUF4144 protein structure with unknown function # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 6.6 0.2 0.0052 9.6 39 80 .. 534 575 .. 507 580 .. 0.84 2 ? 6.2 0.1 0.0066 12 39 80 .. 598 639 .. 580 644 .. 0.89 Alignments for each domain: == domain 1 score: 6.6 bits; conditional E-value: 0.0052 ETT-EEEEE-T.....TSSEEEEEE--HHHHHHHHHHHHHHH CS DUF4144 39 DseGksyslkekaseklalvkteqqlsleelielvrahasak 80 D+eG + +++k+++ la++ ++ + +++l+elvr+h++a+ gi|223460528|gb|AAI36645.1| 534 DEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQ 575 8889999999999*************************9875 PP == domain 2 score: 6.2 bits; conditional E-value: 0.0066 ETT-EEEEE-T.....TSSEEEEEE--HHHHHHHHHHHHHHH CS DUF4144 39 DseGksyslkekaseklalvkteqqlsleelielvrahasak 80 D+eG + +++k+++ la++ ++ + +++l+elvr+h++a+ gi|223460528|gb|AAI36645.1| 598 DEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQ 639 78888889999999************************9875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1681 residues) Target model(s): 14831 (2610332 nodes) Passed MSV filter: 2315 (0.156092); expected 296.6 (0.02) Passed bias filter: 255 (0.0171937); expected 296.6 (0.02) Passed Vit filter: 54 (0.00364102); expected 14.8 (0.001) Passed Fwd filter: 14 (0.000943969); expected 0.1 (1e-05) Initial search space (Z): 14831 [actual number of targets] Domain search space (domZ): 8 [number of targets reported over threshold] # CPU time: 0.86u 0.28s 00:00:01.14 Elapsed: 00:00:00.28 # Mc/sec: 15671.31 // Query: gi|133908631|ref|NP_620710.2| [L=474] Description: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 isoform b [Homo sapiens] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.7e-26 90.0 0.1 1.5e-25 88.6 0.1 1.8 1 SWIB SWIB/MDM2 domain ------ inclusion threshold ------ 0.11 12.0 0.5 0.19 11.2 0.0 1.6 2 SusD SusD family 0.11 12.7 0.1 0.25 11.5 0.0 1.6 1 PH PH domain Domain annotation for each model (and alignments): >> SWIB SWIB/MDM2 domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 88.6 0.1 3.1e-29 1.5e-25 2 76 .] 292 366 .. 291 366 .. 0.96 Alignments for each domain: == domain 1 score: 88.6 bits; conditional E-value: 3.1e-29 CCCECHHHHHHHHCT-SCE-HHHHHHHHHHHHHHHT-B-SSSTTEEE-TSHHHHHCHTSEEETTCTHHHHHHHCC CS SWIB 2 tkpvklspdLakflGadelsrtevvkklwqYIkeknLqDpknkkeilCDekLkklfggdrvkmfeikkllskhli 76 + ++kl+p+La++lG ++++r+ ++++lwqYIk+++LqDp++++ ++CD++L+++f+ +r+k+ ei++ l+ +l+ gi|133908631|ref|NP_620710.2| 292 PPQFKLDPRLARLLGIHTQTRPVIIQALWQYIKTHKLQDPHEREFVICDKYLQQIFESQRMKFSEIPQRLHALLM 366 6789******************************************************************98875 PP >> SusD SusD family # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 11.2 0.0 3.9e-05 0.19 155 206 .. 95 155 .. 82 229 .. 0.71 2 ? -2.6 0.0 0.62 3.1e+03 186 205 .. 434 453 .. 410 469 .. 0.71 Alignments for each domain: == domain 1 score: 11.2 bits; conditional E-value: 3.9e-05 HHHHHHHHTT-----S-SS...........HHHHHHHHHHHHHHHTTTTT-HHHHHHHH.T CS SusD 155 ylnkvReRAglpaltdaaaktt........kdalldaildERrrElagEgkRwfDlrRw.k 206 +++ R+R ++++ ++++ k+++ d il R rEl+ E + ++Dl + + gi|133908631|ref|NP_620710.2| 95 GMDQSRKRPAPQQIQQVQQQAVqnrnhnakKKKMADKILPQRIRELVPESQAYMDLLAFeR 155 455555554222222222222244566666**************************87752 PP == domain 2 score: -2.6 bits; conditional E-value: 0.62 HHHHHHTTTTT-HHHHHHHH CS SusD 186 dERrrElagEgkRwfDlrRw 205 ERr E+++ + + ++R+ gi|133908631|ref|NP_620710.2| 434 EERRAEFYFQPWAQEAVCRY 453 58999999887777777776 PP >> PH PH domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 11.5 0.0 5.1e-05 0.25 6 91 .. 320 416 .. 315 419 .. 0.82 Alignments for each domain: == domain 1 score: 11.5 bits; conditional E-value: 5.1e-05 EEEEEETTSSSEEEEEEEEET...TEEEEESSTTT.......TCESSESEEEESTTEEEEEECTTTCSTTSSSSEEEEEE CS PH 6 yllkksellktwkkryfvLts...nyLlyfksskk.......ksykapkgsiplndctvkkasstkfgaqkesnnyfeit 75 + + k+++l+ +++r fv + +++++ + k+ + + p i +n + + ++k k+ + + + gi|133908631|ref|NP_620710.2| 320 WQYIKTHKLQDPHEREFVICDkylQQIFESQRMKFseipqrlHALLMPPEPIIINHVISVDPNDQK----KTACYDIDVE 395 6678899**************77777777777777**********************666666664....5666666666 PP ETTS.....EEEEEEESSHHH CS PH 76 fknv.....esyllsaeseee 91 ++++ +s+lls+ s++e gi|133908631|ref|NP_620710.2| 396 VDDTlktqmNSFLLSTASQQE 416 66669999*********9998 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (474 residues) Target model(s): 14831 (2610332 nodes) Passed MSV filter: 931 (0.0627739); expected 296.6 (0.02) Passed bias filter: 419 (0.0282516); expected 296.6 (0.02) Passed Vit filter: 33 (0.00222507); expected 14.8 (0.001) Passed Fwd filter: 3 (0.000202279); expected 0.1 (1e-05) Initial search space (Z): 14831 [actual number of targets] Domain search space (domZ): 3 [number of targets reported over threshold] # CPU time: 0.33u 0.28s 00:00:00.61 Elapsed: 00:00:00.22 # Mc/sec: 5624.08 // Query: gi|223460086|gb|AAI36323.1| [L=494] Description: SMARCD2 protein [Homo sapiens] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.1e-21 73.6 0.0 1.6e-20 72.5 0.0 1.6 1 SWIB SWIB/MDM2 domain Domain annotation for each model (and alignments): >> SWIB SWIB/MDM2 domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 72.5 0.0 1.1e-24 1.6e-20 2 74 .. 271 343 .. 270 345 .. 0.96 Alignments for each domain: == domain 1 score: 72.5 bits; conditional E-value: 1.1e-24 CCCECHHHHHHHHCT-SCE-HHHHHHHHHHHHHHHT-B-SSSTTEEE-TSHHHHHCHTSEEETTCTHHHHHHH CS SWIB 2 tkpvklspdLakflGadelsrtevvkklwqYIkeknLqDpknkkeilCDekLkklfggdrvkmfeikkllskh 74 + ++kl+p+La++lG ++++r ++++lw YIk+++LqD +++++i+C+ +++++f++ r+++ ei+ +l+ + gi|223460086|gb|AAI36323.1| 271 PPQYKLDPRLARLLGVHTQTRAAIMQALWLYIKHNQLQDGHEREYINCNRYFRQIFSCGRLRFSEIPMKLAGL 343 6789****************************************************************99866 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (494 residues) Target model(s): 14831 (2610332 nodes) Passed MSV filter: 609 (0.0410626); expected 296.6 (0.02) Passed bias filter: 424 (0.0285888); expected 296.6 (0.02) Passed Vit filter: 32 (0.00215764); expected 14.8 (0.001) Passed Fwd filter: 1 (6.74263e-05); expected 0.1 (1e-05) Initial search space (Z): 14831 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.32u 0.33s 00:00:00.65 Elapsed: 00:00:00.24 # Mc/sec: 5372.93 // Query: gi|51477702|ref|NP_001003801.1| [L=483] Description: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3 isoform 2 [Homo sapiens] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-22 77.9 0.0 7.2e-22 76.8 0.0 1.6 1 SWIB SWIB/MDM2 domain Domain annotation for each model (and alignments): >> SWIB SWIB/MDM2 domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 76.8 0.0 4.9e-26 7.2e-22 2 75 .. 260 333 .. 259 334 .. 0.96 Alignments for each domain: == domain 1 score: 76.8 bits; conditional E-value: 4.9e-26 CCCECHHHHHHHHCT-SCE-HHHHHHHHHHHHHHHT-B-SSSTTEEE-TSHHHHHCHTSEEETTCTHHHHHHHC CS SWIB 2 tkpvklspdLakflGadelsrtevvkklwqYIkeknLqDpknkkeilCDekLkklfggdrvkmfeikkllskhl 75 + ++kl+p+La++lG +++sr+ +v++lwqY+k+++LqD+++k++i+ D++++++f++ r+k+ ei++ l+ +l gi|51477702|ref|NP_001003801.1| 260 PPQFKLDPRLARLLGLHTQSRSAIVQALWQYVKTNRLQDSHDKEYINGDKYFQQIFDCPRLKFSEIPQRLTALL 333 6789******************************************************************9876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (483 residues) Target model(s): 14831 (2610332 nodes) Passed MSV filter: 623 (0.0420066); expected 296.6 (0.02) Passed bias filter: 370 (0.0249477); expected 296.6 (0.02) Passed Vit filter: 20 (0.00134853); expected 14.8 (0.001) Passed Fwd filter: 1 (6.74263e-05); expected 0.1 (1e-05) Initial search space (Z): 14831 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.39u 0.26s 00:00:00.65 Elapsed: 00:00:00.26 # Mc/sec: 4849.19 // Query: gi|21264353|ref|NP_003069.2| [L=470] Description: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3 isoform 1 [Homo sapiens] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-22 77.9 0.0 6.9e-22 76.9 0.0 1.6 1 SWIB SWIB/MDM2 domain Domain annotation for each model (and alignments): >> SWIB SWIB/MDM2 domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 76.9 0.0 4.7e-26 6.9e-22 2 75 .. 247 320 .. 246 321 .. 0.96 Alignments for each domain: == domain 1 score: 76.9 bits; conditional E-value: 4.7e-26 CCCECHHHHHHHHCT-SCE-HHHHHHHHHHHHHHHT-B-SSSTTEEE-TSHHHHHCHTSEEETTCTHHHHHHHC CS SWIB 2 tkpvklspdLakflGadelsrtevvkklwqYIkeknLqDpknkkeilCDekLkklfggdrvkmfeikkllskhl 75 + ++kl+p+La++lG +++sr+ +v++lwqY+k+++LqD+++k++i+ D++++++f++ r+k+ ei++ l+ +l gi|21264353|ref|NP_003069.2| 247 PPQFKLDPRLARLLGLHTQSRSAIVQALWQYVKTNRLQDSHDKEYINGDKYFQQIFDCPRLKFSEIPQRLTALL 320 6789******************************************************************9876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues) Target model(s): 14831 (2610332 nodes) Passed MSV filter: 602 (0.0405907); expected 296.6 (0.02) Passed bias filter: 359 (0.0242061); expected 296.6 (0.02) Passed Vit filter: 20 (0.00134853); expected 14.8 (0.001) Passed Fwd filter: 1 (6.74263e-05); expected 0.1 (1e-05) Initial search space (Z): 14831 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.36u 0.28s 00:00:00.64 Elapsed: 00:00:00.25 # Mc/sec: 4907.42 // Query: gi|51477702|ref|NP_001003801.1| [L=483] Description: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3 isoform 2 [Homo sapiens] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-22 77.9 0.0 7.2e-22 76.8 0.0 1.6 1 SWIB SWIB/MDM2 domain Domain annotation for each model (and alignments): >> SWIB SWIB/MDM2 domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 76.8 0.0 4.9e-26 7.2e-22 2 75 .. 260 333 .. 259 334 .. 0.96 Alignments for each domain: == domain 1 score: 76.8 bits; conditional E-value: 4.9e-26 CCCECHHHHHHHHCT-SCE-HHHHHHHHHHHHHHHT-B-SSSTTEEE-TSHHHHHCHTSEEETTCTHHHHHHHC CS SWIB 2 tkpvklspdLakflGadelsrtevvkklwqYIkeknLqDpknkkeilCDekLkklfggdrvkmfeikkllskhl 75 + ++kl+p+La++lG +++sr+ +v++lwqY+k+++LqD+++k++i+ D++++++f++ r+k+ ei++ l+ +l gi|51477702|ref|NP_001003801.1| 260 PPQFKLDPRLARLLGLHTQSRSAIVQALWQYVKTNRLQDSHDKEYINGDKYFQQIFDCPRLKFSEIPQRLTALL 333 6789******************************************************************9876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (483 residues) Target model(s): 14831 (2610332 nodes) Passed MSV filter: 623 (0.0420066); expected 296.6 (0.02) Passed bias filter: 370 (0.0249477); expected 296.6 (0.02) Passed Vit filter: 20 (0.00134853); expected 14.8 (0.001) Passed Fwd filter: 1 (6.74263e-05); expected 0.1 (1e-05) Initial search space (Z): 14831 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.33u 0.31s 00:00:00.64 Elapsed: 00:00:00.23 # Mc/sec: 5481.70 // Query: gi|51477704|ref|NP_001003802.1| [L=470] Description: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3 isoform 1 [Homo sapiens] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-22 77.9 0.0 6.9e-22 76.9 0.0 1.6 1 SWIB SWIB/MDM2 domain Domain annotation for each model (and alignments): >> SWIB SWIB/MDM2 domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 76.9 0.0 4.7e-26 6.9e-22 2 75 .. 247 320 .. 246 321 .. 0.96 Alignments for each domain: == domain 1 score: 76.9 bits; conditional E-value: 4.7e-26 CCCECHHHHHHHHCT-SCE-HHHHHHHHHHHHHHHT-B-SSSTTEEE-TSHHHHHCHTSEEETTCTHHHHHHHC CS SWIB 2 tkpvklspdLakflGadelsrtevvkklwqYIkeknLqDpknkkeilCDekLkklfggdrvkmfeikkllskhl 75 + ++kl+p+La++lG +++sr+ +v++lwqY+k+++LqD+++k++i+ D++++++f++ r+k+ ei++ l+ +l gi|51477704|ref|NP_001003802.1| 247 PPQFKLDPRLARLLGLHTQSRSAIVQALWQYVKTNRLQDSHDKEYINGDKYFQQIFDCPRLKFSEIPQRLTALL 320 6789******************************************************************9876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues) Target model(s): 14831 (2610332 nodes) Passed MSV filter: 602 (0.0405907); expected 296.6 (0.02) Passed bias filter: 359 (0.0242061); expected 296.6 (0.02) Passed Vit filter: 20 (0.00134853); expected 14.8 (0.001) Passed Fwd filter: 1 (6.74263e-05); expected 0.1 (1e-05) Initial search space (Z): 14831 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.31u 0.24s 00:00:00.55 Elapsed: 00:00:00.20 # Mc/sec: 6134.28 // Query: gi|23396463|sp|O96019.1|ACL6A_HUMAN [L=429] Description: RecName: Full=Actin-like protein 6A; AltName: Full=53 kDa BRG1-associated factor A; AltName: Full=Actin-related protein Baf53a; AltName: Full=ArpNbeta; AltName: Full=BRG1-associated factor 53A; Short=BAF53A; AltName: Full=INO80 complex subunit K Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-144 479.5 0.0 5.6e-144 479.3 0.0 1.0 1 Actin Actin 0.0036 15.9 0.0 0.018 13.6 0.0 2.0 2 MreB_Mbl MreB/Mbl protein ------ inclusion threshold ------ 0.08 12.7 0.1 1.2 8.9 0.0 2.3 2 gag-asp_proteas gag-polyprotein putative aspartyl protease 0.15 11.4 0.0 0.27 10.6 0.0 1.3 1 MobA_MobL MobA/MobL family Domain annotation for each model (and alignments): >> Actin Actin # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 479.3 0.0 1.5e-147 5.6e-144 1 392 [. 8 428 .. 8 429 .] 0.98 Alignments for each domain: == domain 1 score: 479.3 bits; conditional E-value: 1.5e-147 Actin 1 gdevsavVlDnGssttkaGfagedaPkavipsvvgkprgekvea...............klyvgdeale.krpe 58 gdev a+V+D Gs+t++aG+aged+Pk+ +p+++g + +++ + ++y++++al+ +r++ gi|23396463|sp|O96019.1|ACL6A_HUMAN 8 GDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGStlmeidgdkgkqggpTYYIDTNALRvPREN 81 699********************************666665444678899******************989*** PP Actin 59 levrnpvedGvvedwdameelwehvlkeelkvdpeehpllltepplnppanrekateivfEkfkvpalylaksa 132 +e +p+++G+vedwd+++++++h++k ++k + + hp+l+ e+p+n++a+rek+te++fE++++pa++l+k+a gi|23396463|sp|O96019.1|ACL6A_HUMAN 82 MEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWNTRAKREKLTELMFEHYNIPAFFLCKTA 155 ************************************************************************** PP Actin 133 vlsayasgkatglvvDsGasvtsvvpvleGlvLkkairrldlgGkalteqlkellsskkvevtprylikkkkav 206 vl+a+a+g++tgl++DsGa++t+++pv++G+vL+++i++++l+G+++t q++el++++++e++p y+i++k+av gi|23396463|sp|O96019.1|ACL6A_HUMAN 156 VLTAFANGRSTGLILDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFITMQCRELFQEMNIELVPPYMIASKEAV 229 ************************************************************************** PP Actin 207 e................tesfktleeeevleeiKesvcevsddpegekaeasseepessYeLPDgseiilgeer 264 + t+s+++++ + v+++++ sv++vsd+ + +++++++ p+++Ye+P+g+++++g+er gi|23396463|sp|O96019.1|ACL6A_HUMAN 230 RegspanwkrkeklpqvTRSWHNYMCNCVIQDFQASVLQVSDSTY--DEQVAAQMPTVHYEFPNGYNCDFGAER 301 99******************************************9..9************************** PP Actin 265 frvpEilFdpsligsesaleekkllgiaelivaainacdvdlrkeLlanivvtGGtsllpglteRlekelaqla 338 ++pE lFdps+++ s +++lg+++++++++ +cd+d+r+ L+++++v+GG++l++ +t+Rl++el+q + gi|23396463|sp|O96019.1|ACL6A_HUMAN 302 LKIPEGLFDPSNVKGLSG---NTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGNTLIQSFTDRLNRELSQKT 372 *************99888...9**************************************************** PP Actin 339 psgvkvkiiapea..erkysaWiGGSiLAslgtfqqlwvskqeYeEkGssvverkc 392 p+++++k ia+++ er++s+WiGGSiLAslgtfqq+w+skqeYeE G+++verkc gi|23396463|sp|O96019.1|ACL6A_HUMAN 373 PPSMRLKLIANNTtvERRFSSWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKC 428 ************9******************************************* PP >> MreB_Mbl MreB/Mbl protein # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 13.6 0.0 4.8e-06 0.018 54 101 .. 79 126 .. 73 144 .. 0.85 2 ? -1.0 0.0 0.14 5.1e+02 276 297 .. 347 368 .. 323 374 .. 0.87 Alignments for each domain: == domain 1 score: 13.6 bits; conditional E-value: 4.8e-06 GTTEEEE-SEETTEESSHHHHHHHHHHHHHHHHTSS-SS--EEEEEE- CS MreB_Mbl 54 pgnikavrPlkdGviadlevaeellkyfikkvkkkkslskprvvicvP 101 ++n++a+ Plk+G+++d + +++l + k+ k+++ +p ++ P gi|23396463|sp|O96019.1|ACL6A_HUMAN 79 RENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAP 126 579**************************9999988877777665555 PP == domain 2 score: -1.0 bits; conditional E-value: 0.14 -EEEESGGGGSBTHHHHHHHHH CS MreB_Mbl 276 givltGGgallkgldkllseet 297 +++++GG +l++ + + l++e+ gi|23396463|sp|O96019.1|ACL6A_HUMAN 347 SVIVAGGNTLIQSFTDRLNREL 368 58999********999998876 PP >> gag-asp_proteas gag-polyprotein putative aspartyl protease # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 8.9 0.0 0.00033 1.2 8 31 .. 154 177 .. 150 181 .. 0.87 2 ? 1.0 0.0 0.099 3.7e+02 35 57 .. 358 379 .. 352 390 .. 0.82 Alignments for each domain: == domain 1 score: 8.9 bits; conditional E-value: 0.00033 gag-asp_proteas 8 lltvevsiggvtvkaliDtGAtgs 31 ++++++ +g+ + + +D+GAt++ gi|23396463|sp|O96019.1|ACL6A_HUMAN 154 TAVLTAFANGRSTGLILDSGATHT 177 67788889***************8 PP == domain 2 score: 1.0 bits; conditional E-value: 0.099 gag-asp_proteas 35 eslaarLglaleaiqsrksvrlA 57 +s+ +rL+ +l++++ + s+rl gi|23396463|sp|O96019.1|ACL6A_HUMAN 358 QSFTDRLNRELSQKT-PPSMRLK 379 6899***********.9999975 PP >> MobA_MobL MobA/MobL family # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 10.6 0.0 7.2e-05 0.27 156 206 .. 235 287 .. 212 293 .. 0.86 Alignments for each domain: == domain 1 score: 10.6 bits; conditional E-value: 7.2e-05 MobA_MobL 156 edwkskelveelRkeWad.saNaaLek.kgidaridhrsyekqgieriptihl 206 +wk+ke++ ++ + W + ++N ++++ ++ +++++ +y++q ++pt+h gi|23396463|sp|O96019.1|ACL6A_HUMAN 235 ANWKRKEKLPQVTRSWHNyMCNCVIQDfQASVLQVSDSTYDEQVAAQMPTVHY 287 68**************99458999998344558******************95 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (429 residues) Target model(s): 14831 (2610332 nodes) Passed MSV filter: 273 (0.0184074); expected 296.6 (0.02) Passed bias filter: 253 (0.0170589); expected 296.6 (0.02) Passed Vit filter: 21 (0.00141595); expected 14.8 (0.001) Passed Fwd filter: 4 (0.000269705); expected 0.1 (1e-05) Initial search space (Z): 14831 [actual number of targets] Domain search space (domZ): 4 [number of targets reported over threshold] # CPU time: 0.31u 0.21s 00:00:00.52 Elapsed: 00:00:00.21 # Mc/sec: 5332.54 // Query: gi|23396462|sp|O94805.1|ACL6B_HUMAN [L=426] Description: RecName: Full=Actin-like protein 6B; AltName: Full=53 kDa BRG1-associated factor B; AltName: Full=Actin-related protein Baf53b; AltName: Full=ArpNalpha; AltName: Full=BRG1-associated factor 53B; Short=BAF53B Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.7e-142 472.5 0.0 7.6e-142 472.3 0.0 1.0 1 Actin Actin ------ inclusion threshold ------ 0.016 13.8 0.0 0.75 8.3 0.0 2.2 2 MreB_Mbl MreB/Mbl protein 0.097 12.4 0.2 0.41 10.4 0.1 2.0 2 gag-asp_proteas gag-polyprotein putative aspartyl protease Domain annotation for each model (and alignments): >> Actin Actin # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 472.3 0.0 1.5e-145 7.6e-142 1 392 [. 8 425 .. 8 426 .] 0.96 Alignments for each domain: == domain 1 score: 472.3 bits; conditional E-value: 1.5e-145 Actin 1 gdevsavVlDnGssttkaGfagedaPkavipsvvg............kprgekvea.......klyvgdeale. 54 gdev a+V+D Gs +++aG+aged+Pka +p+ vg + ++++++al+ gi|23396462|sp|O94805.1|ACL6B_HUMAN 8 GDEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGllaaeeggglelE-------GdkekkgkIFHIDTNALHv 74 699********************************7776666666443.......04444455899*******8 PP Actin 55 krpelevrnpvedGvvedwdameelwehvlkeelkvdpeehpllltepplnppanrekateivfEkfkvpalyl 128 +r++ ev +p+++G++edw+ ++++++h++ +++k +p+ hp+l+ e+p+n++a+rek+te++fE++++pa++l gi|23396462|sp|O94805.1|ACL6B_HUMAN 75 PRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAKREKLTELMFEQYNIPAFFL 148 9************************************************************************* PP Actin 129 aksavlsayasgkatglvvDsGasvtsvvpvleGlvLkkairrldlgGkalteqlkellsskkvevtprylikk 202 +k+avl+a+a+g++tglv+DsGa++t+++pv++G+vL+++i++++l+G++++ q++el++++ ++++p y+i+ gi|23396462|sp|O94805.1|ACL6B_HUMAN 149 CKTAVLTAFANGRSTGLVLDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFISMQCRELFQEMAIDIIPPYMIAA 222 ************************************************************************** PP Actin 203 kkave................tesfktleeeevleeiKesvcevsddpegekaeasseepessYeLPDgseiil 260 k++v+ +s+++++ +ev+++++ sv++vsd+p+ +++++++ p+++Ye+P+g++++ gi|23396462|sp|O94805.1|ACL6B_HUMAN 223 KEPVRegappnwkkkeklpqvSKSWHNYMCNEVIQDFQASVLQVSDSPY--DEQVAAQMPTVHYEMPNGYNTDY 294 ****9*******************************************9..9********************** PP Actin 261 geerfrvpEilFdpsligsesaleekkllgiaelivaainacdvdlrkeLlanivvtGGtsllpglteRlekel 334 g+er r+pE lFdps+++ s +++lg+ ++++++i +cd+d+r+ L+++++vtGG++ll+g+t+Rl++el gi|23396462|sp|O94805.1|ACL6B_HUMAN 295 GAERLRIPEGLFDPSNVKGLSG---NTMLGVGHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNREL 365 *****************99888...9************************************************ PP Actin 335 aqlapsgvkvkiiapea..erkysaWiGGSiLAslgtfqqlwvskqeYeEkGssvverkc 392 +q +p+++++k ia+++ erk+s WiGGSiLAslgtfqq+w+skqeYeE G+++verkc gi|23396462|sp|O94805.1|ACL6B_HUMAN 366 SQKTPPSMRLKLIASNStmERKFSPWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKC 425 ***************999****************************************** PP >> MreB_Mbl MreB/Mbl protein # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 8.3 0.0 0.00015 0.75 58 97 .. 80 119 .. 68 148 .. 0.85 2 ? 3.1 0.0 0.0057 28 276 298 .. 344 366 .. 319 373 .. 0.89 Alignments for each domain: == domain 1 score: 8.3 bits; conditional E-value: 0.00015 EEE-SEETTEESSHHHHHHHHHHHHHHHHTSS-SS--EEE CS MreB_Mbl 58 kavrPlkdGviadlevaeellkyfikkvkkkkslskprvv 97 +++ Plk+G+i+d e+ ++l + +k k++ +p ++ gi|23396462|sp|O94805.1|ACL6B_HUMAN 80 EVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLM 119 789*********************9999887766666555 PP == domain 2 score: 3.1 bits; conditional E-value: 0.0057 -EEEESGGGGSBTHHHHHHHHHS CS MreB_Mbl 276 givltGGgallkgldkllseetg 298 ++++tGG +ll+g+ + l++e++ gi|23396462|sp|O94805.1|ACL6B_HUMAN 344 SVIVTGGNTLLQGFTDRLNRELS 366 5899************9998875 PP >> gag-asp_proteas gag-polyprotein putative aspartyl protease # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 10.4 0.1 8.3e-05 0.41 8 31 .. 151 174 .. 147 178 .. 0.87 2 ? -1.7 0.0 0.52 2.6e+03 37 56 .. 357 375 .. 355 380 .. 0.85 Alignments for each domain: == domain 1 score: 10.4 bits; conditional E-value: 8.3e-05 gag-asp_proteas 8 lltvevsiggvtvkaliDtGAtgs 31 ++++++ +g+ + +++D+GAt++ gi|23396462|sp|O94805.1|ACL6B_HUMAN 151 TAVLTAFANGRSTGLVLDSGATHT 174 67788889***************8 PP == domain 2 score: -1.7 bits; conditional E-value: 0.52 gag-asp_proteas 37 laarLglaleaiqsrksvrl 56 + +rL+ +l++++ + s+rl gi|23396462|sp|O94805.1|ACL6B_HUMAN 357 FTDRLNRELSQKT-PPSMRL 375 5689*******99.999987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (426 residues) Target model(s): 14831 (2610332 nodes) Passed MSV filter: 363 (0.0244758); expected 296.6 (0.02) Passed bias filter: 345 (0.0232621); expected 296.6 (0.02) Passed Vit filter: 25 (0.00168566); expected 14.8 (0.001) Passed Fwd filter: 3 (0.000202279); expected 0.1 (1e-05) Initial search space (Z): 14831 [actual number of targets] Domain search space (domZ): 3 [number of targets reported over threshold] # CPU time: 0.27u 0.23s 00:00:00.50 Elapsed: 00:00:00.18 # Mc/sec: 6177.79 //