# hmmscan :: search sequence(s) against a profile database # HMMER 3.0 (March 2010); http://hmmer.org/ # Copyright (C) 2010 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: SET.fa # target HMM database: /N/dc2/projects/marinovg/genomes/PFam/PFam27.0/Pfam-A.hmm # output directed to file: SET.PFam-27-A # per-seq hits tabular output: SET.tblout # number of worker threads: 16 # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: gi|38382764|gb|AAH62338.1| [L=242] Description: SETBP1 protein [Homo sapiens] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- ------ inclusion threshold ------ 0.087 12.9 2.6 0.76 9.9 0.1 2.3 2 Lipoprotein_17 Lipoprotein associated domain Domain annotation for each model (and alignments): >> Lipoprotein_17 Lipoprotein associated domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 9.9 0.1 5.1e-05 0.76 41 72 .. 87 115 .. 69 137 .. 0.72 2 ? 3.1 0.2 0.007 1e+02 7 40 .. 153 184 .. 139 189 .. 0.73 Alignments for each domain: == domain 1 score: 9.9 bits; conditional E-value: 5.1e-05 TTEEEEEEEE-THHHHHTEEEEEEEETTTXXE CS Lipoprotein_17 41 ngvsfsikivssanDeeGtLkvkvtlsknnks 72 ++++fsik + an +eG+Lk+k++ +k k+ gi|38382764|gb|AAH62338.1| 87 EEQEFSIK--E-ANFTEGSLKLKIQTTKRAKK 115 56677775..5.************98665533 PP == domain 2 score: 3.1 bits; conditional E-value: 0.007 T--BTTTEEETTSTT--GGGS-HHHEEE-S..-T CS Lipoprotein_17 7 nlelknsnkkntlpSevtnsnlkndnfitfpntk 40 + e + s+kk + +S + +s+lk f+++++++ gi|38382764|gb|AAH62338.1| 153 EEERSHSKKKLLTASDLAASDLK--GFQPQIKDS 184 444455556889999*******9..888886655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (242 residues) Target model(s): 14831 (2610332 nodes) Passed MSV filter: 618 (0.0416695); expected 296.6 (0.02) Passed bias filter: 364 (0.0245432); expected 296.6 (0.02) Passed Vit filter: 19 (0.0012811); expected 14.8 (0.001) Passed Fwd filter: 1 (6.74263e-05); expected 0.1 (1e-05) Initial search space (Z): 14831 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.17u 0.21s 00:00:00.38 Elapsed: 00:00:00.33 # Mc/sec: 1914.24 // Query: gi|55741677|ref|NP_055527.1| [L=1707] Description: histone-lysine N-methyltransferase SETD1A [Homo sapiens] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-32 112.6 0.1 1.6e-32 112.6 0.1 4.5 4 N-SET COMPASS (Complex proteins associated with Set1p) c 5.3e-21 75.6 0.4 5.3e-21 75.6 0.3 4.3 4 SET SET domain 1.4e-06 27.7 0.0 2.7e-06 26.9 0.0 1.4 1 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP do 0.0018 18.1 0.0 0.0034 17.3 0.0 1.4 1 RRM_6 RNA recognition motif (a.k.a. RRM, RBD, or RNP dom Domain annotation for each model (and alignments): >> N-SET COMPASS (Complex proteins associated with Set1p) component N # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.0 0.6 0.78 2.9e+03 29 75 .. 805 852 .. 799 862 .. 0.38 2 ? -11.6 8.4 4 1.5e+04 50 64 .. 995 1010 .. 970 1063 .. 0.47 3 ? -1.7 1.6 0.6 2.2e+03 108 147 .. 1354 1390 .. 1342 1400 .. 0.47 4 ! 112.6 0.1 4.4e-36 1.6e-32 1 167 [] 1418 1558 .. 1418 1558 .. 0.86 Alignments for each domain: == domain 1 score: -2.0 bits; conditional E-value: 0.78 N-SET 29 vleeleqkeidsdv..lnieywvwkqkeikken.eeiseeeerkeekaeg 75 ++++ ++ ++ ++v + w w++ke+k+ ++ ++++++e+k e+ gi|55741677|ref|NP_055527.1| 805 IMQRDLNRKMVENVafGAFDQW-WESKEEKAKPfQNAAKQQAKEEDK-EK 852 5555555554444422222222.222222222223333333322333.22 PP == domain 2 score: -11.6 bits; conditional E-value: 4 N-SET 50 wkqkeikken.eeise 64 +++k++++++ +e++e gi|55741677|ref|NP_055527.1| 995 DTTKKETEVSdGEDEE 1010 3333333333211111 PP == domain 3 score: -1.7 bits; conditional E-value: 0.6 N-SET 108 vqkaletvqaeekedekatakesasntkaksssRenRann 147 +q+++e+ + e +e+ + +e+++++ + sss a gi|55741677|ref|NP_055527.1| 1354 LQQQREEGEEEGEEEGE---EEEEESSDSSSSSDGEGALR 1390 33333333333222222...22334444444444444444 PP == domain 4 score: 112.6 bits; conditional E-value: 4.4e-36 N-SET 1 ekeksetldlddlqelikDeEDlkflkevleeleqkeidsdvlnieywvwkqkeikkeneeiseeeerkeekaegslle 79 ++e++++++l+d++++++D+ED+++l+ ++e+l+q+++++d+ln+++wv+++ i+++ ++++ +++ ++ +e gi|55741677|ref|NP_055527.1| 1418 RSEFEQMTILYDIWNSGLDSEDMSYLRLTYERLLQQTSGADWLNDTHWVHHT--ITNL--TTPKR----KRRPQDGPRE 1488 5899***********************************************9..5666..22322....33456899** PP N-SET 80 hktGcarseGykkIpdkeKskYLphrkkvqkaletvqaeekedekatakesasntkaksssRenRannRRlladieaqk 158 h+tG+arseGy+ I++keK+kYL+ ++le +++ ++++ +e+R+++RRll++i++++ gi|55741677|ref|NP_055527.1| 1489 HQTGSARSEGYYPISKKEKDKYLDVCPVSARQLE--GV--------------DTQGTNRVLSERRSEQRRLLSAIGTSA 1551 **************************64444444..33..............345889*******************96 PP N-SET 159 aigteSDlL 167 ++SDlL gi|55741677|ref|NP_055527.1| 1552 --IMDSDLL 1558 ..9*****8 PP >> SET SET domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.4 0.2 1.4 5e+03 58 75 .. 340 357 .. 234 387 .. 0.61 2 ? -10.8 8.5 4 1.5e+04 52 60 .. 978 993 .. 803 1075 .. 0.60 3 ? -0.9 0.1 0.46 1.7e+03 11 56 .. 1331 1378 .. 1281 1434 .. 0.60 4 ! 75.6 0.3 1.4e-24 5.3e-21 2 161 .. 1580 1684 .. 1579 1685 .. 0.93 Alignments for each domain: == domain 1 score: -2.4 bits; conditional E-value: 1.4 HHHHHTHHHHHHH.TTTS CS xxxxxxxxxxxxxxxxxx RF SET 58 qkagksvrspaalsarsg 75 + s +s+ + s s gi|55741677|ref|NP_055527.1| 340 SSSSLSSSSSSSSSSSSS 357 122222222222222222 PP == domain 2 score: -10.8 bits; conditional E-value: 4 E.......HHHHHHHH CS x.......xxxxxxxx RF SET 52 a.......akskrqka 60 + +r++a gi|55741677|ref|NP_055527.1| 978 EeddeedeEDEDREEA 993 0222222211111111 PP == domain 3 score: -0.9 bits; conditional E-value: 0.46 -TTEEEEEECCEEEECCCCHH..HHHHHHHHHHC.TTCCTCE....HHHH CS xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx....xxxx RF SET 11 pkgefvceyvgelltddeaekkpelerldlskaleaasrala....aksk 56 p++e v+e ++ +e++ kp+++++++++ +e+ +++ + s+ gi|55741677|ref|NP_055527.1| 1331 PADE-VLEAPEVVVAEAEEP-KPQQLQQQREEGEEEGEEEGEeeeeESSD 1378 4455.333333333333333.34444444444444444444412221111 PP == domain 4 score: 75.6 bits; conditional E-value: 1.4e-24 EEEEESS-B-TTEEEEEECCEEEECCCCHH..HHHHHHHHHHC.TTCCTCEHHHHHHHHHHTHHHHHHH.TTTS.GGG. CS xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF SET 2 rGvrAtedIpkgefvceyvgelltddeaekkpelerldlskaleaasralaakskrqkagksvrspaalsarsgalksa 80 +G++A e+I+++e+v+eyvg+ +++ a+ + ++++ gi|55741677|ref|NP_055527.1| 1580 WGLFAMEPIAADEMVIEYVGQNIRQMVADMR---------------EKRYV---------------------------- 1615 ******************************5...............22222............................ PP .HHHHHHHHHHHHHH.EEETTSSCEEEEECEECCECCCGGGHEESSS.SEEEEEECSTTSSEEEEEESS-B-TTEEEEE CS xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF SET 81 laasvdasesaaepkatedeyeeeeseyvidakllgnlarflNHSCdpNltvqavfvlrlprvaffAtrdIkkGeElti 159 + + +++ ++ +++ +ida+ +gnlarf+NH C+pN++++ + ++ ++++++++++I +eE+t+ gi|55741677|ref|NP_055527.1| 1616 ------------QEGIGSSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQKKIVIYSKQPIGVDEEITY 1682 ............3477899************************************99********************** PP EE CS xx RF SET 160 dY 161 dY gi|55741677|ref|NP_055527.1| 1683 DY 1684 ** PP >> RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 26.9 0.0 7.2e-10 2.7e-06 6 69 .. 101 165 .. 99 166 .. 0.94 Alignments for each domain: == domain 1 score: 26.9 bits; conditional E-value: 7.2e-10 ETTTSSHHHHHHHHHTCSCEEEEEEEEE.TTSSEEEEEEEEESSHHHHHHHHHHHTTEEETTEEE CS RRM_1 6 LppdvteeeLkelFskfGpiesiklvrd.etgrskgfafVeFeseedaekAlealngkklggrel 69 L+ +v e Lk++ +k+G++e++++ +t+++ g a V F+s + a++ +++l+ + ++g+ + gi|55741677|ref|NP_055527.1| 101 LNDNVRETFLKDMCRKYGEVEEVEILLHpRTRKHLGLARVLFTSTRGAKETVKNLHLTSVMGNII 165 778899999***********************************************999999877 PP >> RRM_6 RNA recognition motif (a.k.a. RRM, RBD, or RNP domain) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 17.3 0.0 9.2e-07 0.0034 6 67 .. 101 163 .. 96 166 .. 0.90 Alignments for each domain: == domain 1 score: 17.3 bits; conditional E-value: 9.2e-07 --TT--HHHHHHHHHTTS--GGEEEEE-TT.S-EEEEEEE--SSHHHHHHHHTTTT.EESSS- CS RRM_6 6 lppsvteedlreffepygkvegvriprnkd.grgrgfAfVefespeeAqkalkklnglvlkgr 67 l+ v e+ l+++ ++yg ve+v+i ++++ + g A V f s A++ +k+l+ ++++g gi|55741677|ref|NP_055527.1| 101 LNDNVRETFLKDMCRKYGEVEEVEILLHPRtRKHLGLARVLFTSTRGAKETVKNLHLTSVMGN 163 6667778889999999**************9999**********************9999986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1707 residues) Target model(s): 14831 (2610332 nodes) Passed MSV filter: 1726 (0.116378); expected 296.6 (0.02) Passed bias filter: 502 (0.033848); expected 296.6 (0.02) Passed Vit filter: 212 (0.0142944); expected 14.8 (0.001) Passed Fwd filter: 87 (0.00586609); expected 0.1 (1e-05) Initial search space (Z): 14831 [actual number of targets] Domain search space (domZ): 4 [number of targets reported over threshold] # CPU time: 1.71u 0.37s 00:00:02.08 Elapsed: 00:00:00.61 # Mc/sec: 7304.65 // Query: gi|210032580|ref|NP_055863.1| [L=1923] Description: histone-lysine N-methyltransferase SETD1B [Homo sapiens] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-34 118.2 0.0 3.2e-34 118.2 0.0 3.1 4 N-SET COMPASS (Complex proteins associated with Set1p) c 6e-22 78.6 1.8 6e-22 78.6 1.3 3.3 2 SET SET domain 7.5e-11 41.5 0.0 1.4e-10 40.6 0.0 1.4 1 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP do 2.1e-06 27.4 0.0 3.8e-06 26.6 0.0 1.4 1 RRM_5 RNA recognition motif. (a.k.a. RRM, RBD, or RNP do 1.2e-05 25.1 0.1 2.4e-05 24.2 0.0 1.5 1 RRM_6 RNA recognition motif (a.k.a. RRM, RBD, or RNP dom Domain annotation for each model (and alignments): >> N-SET COMPASS (Complex proteins associated with Set1p) component N # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.3 0.1 2.5 7.3e+03 26 71 .. 872 919 .. 869 927 .. 0.63 2 ? -5.4 3.9 5 1.5e+04 55 72 .. 1047 1063 .. 1030 1089 .. 0.53 3 ? -9.2 6.9 5 1.5e+04 18 65 .. 1076 1140 .. 1058 1162 .. 0.41 4 ! 118.2 0.0 1.1e-37 3.2e-34 1 167 [] 1629 1774 .. 1629 1774 .. 0.91 Alignments for each domain: == domain 1 score: -3.3 bits; conditional E-value: 2.5 N-SET 26 lkevleeleqkeidsdv..lnieywvwkqkeikkeneeiseeeerkee 71 lk ++++ ++ ++ + v + + w +k+++++k + +++++ e k e gi|210032580|ref|NP_055863.1| 872 LKAIMKRDLNRKMVEVVafRAFDEWWDKKERMAKASLTPVKSGEHKDE 919 566666666555554445688899999999999998666664443333 PP == domain 2 score: -5.4 bits; conditional E-value: 5 N-SET 55 ikkeneeiseeeerkeek 72 ++e ee+ eeee++e++ gi|210032580|ref|NP_055863.1| 1047 STEE-EEEAEEEEEEEDD 1063 2222.2222222222222 PP == domain 3 score: -9.2 bits; conditional E-value: 5 N-SET 18 kDeEDlkflkevleeleqkeidsdvlnieywvwkqkeikkeneeise...................e 65 D+ED + + + ++ +++ ++ v+ + ++ + + ++ + +se + gi|210032580|ref|NP_055863.1| 1076 NDDEDTALSEASEKDEGDSDEEETVSIVTSKAEATSSSESSE--SSEfesssesspsssedeeevvA 1140 555665554444444444444433333333333332222221..11111222233334333333332 PP == domain 4 score: 118.2 bits; conditional E-value: 1.1e-37 N-SET 1 ekeksetldlddlqelikDeEDlkflkevleeleqkeidsdvlnieywvwkqkeikkeneeiseeeerkeekaegsll 78 ++e++e+++l+d+++ ++DeED++fl ++e+l+q+++++d+ln+++wv + +++ ++k++k+++ ++ gi|210032580|ref|NP_055863.1| 1629 RSEFEEMTILYDIWNGGIDEEDIRFLCVTYERLLQQDNGMDWLNDTLWVYHPS--TSL-------SSAKKKKRDDGIR 1697 5899************************************************7..333.......2234566789*** PP N-SET 79 ehktGcarseGykkIpdkeKskYLphrkkvqkaletvqaeekedekatakesasntkaksssRenRannRRlladiea 156 eh tGcarseG++ I++k+K +YL++++ ++ a+++ ++ +a+ ++++++++e+R+++RRll++++ gi|210032580|ref|NP_055863.1| 1698 EHVTGCARSEGFYTIDKKDKLRYLNSSR---ASTDEPPADTQGMSI-----PAQPHASTRAGSERRSEQRRLLSSFTG 1767 **************************94...455578999998888.....*************************99 PP N-SET 157 qkaigteSDlL 167 +++SDlL gi|210032580|ref|NP_055863.1| 1768 ----SCDSDLL 1774 ....7*****8 PP >> SET SET domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.5 4.0 0.45 1.3e+03 31 108 .. 1054 1152 .. 953 1158 .. 0.71 2 ! 78.6 1.3 2e-25 6e-22 2 161 .. 1796 1900 .. 1795 1901 .. 0.92 Alignments for each domain: == domain 1 score: -0.5 bits; conditional E-value: 0.45 H..................HHHHHHHHHHC.TTCCTCE.....HHHHHHHHHHTHHHHHHH.TTTS.GGG..HHHHHH CS x................xxxxxxxxxxxxxxxxxxxxx.....xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF SET 31 k................kpelerldlskaleaasrala.....akskrqkagksvrspaalsarsgalksalaasvda 87 + e e++d+++al +as+++ ++ + ++ k++ + ++s +s ++s + s+ gi|210032580|ref|NP_055863.1| 1054 AeeeeeeeddddddsddRDESENDDEDTALSEASEKDEgdsdeEETVSIVTSKAEATSSSESSESSEFESSSESSPSS 1131 044444555555555665566666777777777777777777766667777777777777777777777777777777 PP HHHHHHHH.EEETTSSCEEEE CS xxxxxxxxxxxxxxxxxxxxx RF SET 88 sesaaepkatedeyeeeesey 108 se +e a+e+e eeee+e gi|210032580|ref|NP_055863.1| 1132 SEDEEEVVAREEEEEEEEEEM 1152 777777777777777776665 PP == domain 2 score: 78.6 bits; conditional E-value: 2e-25 EEEEESS-B-TTEEEEEECCEEEECCCCHH..HHHHHHHHHHC.TTCCTCEHHHHHHHHHHTHHHHHHH.TTTS.GGG CS xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF SET 2 rGvrAtedIpkgefvceyvgelltddeaekkpelerldlskaleaasralaakskrqkagksvrspaalsarsgalks 79 +G++A e+I+++e+v+eyvg+ +++ a+ + ++r ++ gi|210032580|ref|NP_055863.1| 1796 WGLFAMEPIAADEMVIEYVGQNIRQVIADMR--------------EKRYED--------------------------- 1832 **************************99995..............222222........................... PP ..HHHHHHHHHHHHHH.EEETTSSCEEEEECEECCECCCGGGHEESSS.SEEEEEECSTTSSEEEEEESS-B-TTEEE CS xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF SET 80 alaasvdasesaaepkatedeyeeeeseyvidakllgnlarflNHSCdpNltvqavfvlrlprvaffAtrdIkkGeEl 157 + ++++++ +++ +ida+ +gn+arf+NHSC+pN++++ + v++ +++++++++ I +eE+ gi|210032580|ref|NP_055863.1| 1833 --------------EGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKKIVIYSKQHINVNEEI 1896 ..............467789********************************************************** PP EEEE CS xxxx RF SET 158 tidY 161 t+dY gi|210032580|ref|NP_055863.1| 1897 TYDY 1900 **** PP >> RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 40.6 0.0 4.6e-14 1.4e-10 6 69 .. 110 174 .. 108 175 .. 0.95 Alignments for each domain: == domain 1 score: 40.6 bits; conditional E-value: 4.6e-14 ETTTSSHHHHHHHHHTCSCEEEEEEEEE.TTSSEEEEEEEEESSHHHHHHHHHHHTTEEETTEEE CS RRM_1 6 LppdvteeeLkelFskfGpiesiklvrd.etgrskgfafVeFeseedaekAlealngkklggrel 69 L+ ++ e+ L+++ +k+G++e++++ ++ +t+++ g+a V F++ + a++A++ l+ + ++g+ + gi|210032580|ref|NP_055863.1| 110 LNDNIRENFLRDMCKKYGEVEEVEILYNpKTKKHLGIAKVVFATVRGAKDAVQHLHSTSVMGNII 174 77899999*****************************************************9977 PP >> RRM_5 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 26.6 0.0 1.3e-09 3.8e-06 1 54 [. 119 177 .. 119 179 .. 0.92 Alignments for each domain: == domain 1 score: 26.6 bits; conditional E-value: 1.3e-09 RRM_5 1 LyklfskfGkverikifrkk.....ggqAfvefdtveaArkakeylngvklggktLkve 54 L++ + k+G+ve++ i+++ g A v f+tv+ A+ a+++l+ + g+ ++ve gi|210032580|ref|NP_055863.1| 119 LRDMCKKYGEVEEVEILYNPktkkhLGIAKVVFATVRGAKDAVQHLHSTSVMGNIIHVE 177 7889************9988998544********************************8 PP >> RRM_6 RNA recognition motif (a.k.a. RRM, RBD, or RNP domain) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 24.2 0.0 8.1e-09 2.4e-05 6 67 .. 110 172 .. 105 175 .. 0.90 Alignments for each domain: == domain 1 score: 24.2 bits; conditional E-value: 8.1e-09 --TT--HHHHHHHHHTTS--GGEEEEE-TT.S-EEEEEEE--SSHHHHHHHHTTTT.EESSS- CS RRM_6 6 lppsvteedlreffepygkvegvriprnkd.grgrgfAfVefespeeAqkalkklnglvlkgr 67 l+ + e lr++ ++yg ve+v+i +n++ ++ g A V f++ A+ a+++l++++++g gi|210032580|ref|NP_055863.1| 110 LNDNIRENFLRDMCKKYGEVEEVEILYNPKtKKHLGIAKVVFATVRGAKDAVQHLHSTSVMGN 172 5666777779999999*************99*************************9999996 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1923 residues) Target model(s): 14831 (2610332 nodes) Passed MSV filter: 1227 (0.0827321); expected 296.6 (0.02) Passed bias filter: 470 (0.0316904); expected 296.6 (0.02) Passed Vit filter: 188 (0.0126762); expected 14.8 (0.001) Passed Fwd filter: 60 (0.00404558); expected 0.1 (1e-05) Initial search space (Z): 14831 [actual number of targets] Domain search space (domZ): 5 [number of targets reported over threshold] # CPU time: 1.55u 0.38s 00:00:01.93 Elapsed: 00:00:00.47 # Mc/sec: 10680.15 // Query: gi|197313748|ref|NP_054878.5| [L=2564] Description: histone-lysine N-methyltransferase SETD2 [Homo sapiens] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-28 98.3 6.9 9.1e-28 96.0 4.8 2.4 1 SRI SRI (Set2 Rpb1 interacting) domain 8.5e-25 87.9 0.1 8.5e-25 87.9 0.0 4.1 3 SET SET domain 8.2e-10 38.3 2.9 8.2e-10 38.3 2.0 2.1 2 WW WW domain ------ inclusion threshold ------ 0.11 11.9 2.9 3.5 7.1 0.1 3.2 3 Med26 TFIIS helical bundle-like domain Domain annotation for each model (and alignments): >> SRI SRI (Set2 Rpb1 interacting) domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 96.0 4.8 2.5e-31 9.1e-28 2 88 .. 2466 2558 .. 2465 2559 .. 0.97 Alignments for each domain: == domain 1 score: 96.0 bits; conditional E-value: 2.5e-31 SRI 2 saekaekkfrkelakhvpnllkkYrke.......lekedlKklakeltkilvkkElkknkskapplelsdkkkkKike 72 a+k+++ frke++++++++l++Yrk+ +++ed+K+la++lt+ +++kElk++k ++++le+++++k+K+ke gi|197313748|ref|NP_054878.5| 2466 LAKKSKEVFRKEMSQFIVQCLNPYRKPdckvgriTTTEDFKHLARKLTHGVMNKELKYCK-NPEDLECNENVKHKTKE 2542 57899*******************************************************.9999************* PP SRI 73 fvkeYmdkvlakykek 88 ++k+Ym+k++a+yk k gi|197313748|ref|NP_054878.5| 2543 YIKKYMQKFGAVYKPK 2558 *************987 PP >> SET SET domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.6 1.7 0.37 1.4e+03 52 113 .. 397 472 .. 250 481 .. 0.72 2 ! 87.9 0.0 2.3e-28 8.5e-25 1 162 [] 1561 1667 .. 1561 1667 .. 0.92 3 ? -7.6 4.0 4 1.5e+04 97 97 .. 1971 1971 .. 1844 2139 .. 0.60 Alignments for each domain: == domain 1 score: -0.6 bits; conditional E-value: 0.37 E..............HHHHHHHHHHTHHHHHHH.TTTS.GGG..HHHHHHHHHHHHHH.EEETTSSCEEEEECEEC CS x..............xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF SET 52 a..............akskrqkagksvrspaalsarsgalksalaasvdasesaaepkatedeyeeeeseyvidak 113 + +++ s+rs + +s+r+ + +s+ ++ +s + +a+e+ ++eee+++++ ++ gi|197313748|ref|NP_054878.5| 397 ErerrrsrshsrserGSRTNLSYSRSERSHYYDSDRRYHRSSPYRERTRYSRPYTDNRARESSDSEEEYKKTYSRR 472 033333444444444667888999999************************9999999999999999988877665 PP == domain 2 score: 87.9 bits; conditional E-value: 2.3e-28 SEEEEESS-B-TTEEEEEECCEEEECCCCHH......HHHHHHHHHHC.TTCCTCEHHHHHHHHHHTHHHHHHH.TTT CS xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx....xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF SET 1 GrGvrAtedIpkgefvceyvgelltddeaek....kpelerldlskaleaasralaakskrqkagksvrspaalsars 74 G+G+rA++d+p ++fv+ey+ge+l ++e + + ++ gi|197313748|ref|NP_054878.5| 1561 GWGLRAAKDLPSNTFVLEYCGEVLDHKEFKArvkeY----------------ARN----------------------- 1599 9******************************65321................222....................... PP S.GGG..HHHHHHHHHHHHHH.EEETTSSCEEEEECEECCECCCGGGHEESSS.SEEEEEECSTTSSEEEEEESS-B- CS xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF SET 75 galksalaasvdasesaaepkatedeyeeeeseyvidakllgnlarflNHSCdpNltvqavfvlrlprvaffAtrdIk 152 k+ ++++ +++++ida+++gn +rf+NHSC+pN++ q + v++ rv+ff+t+ ++ gi|197313748|ref|NP_054878.5| 1600 --------------------KNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVP 1657 ....................355689**************************************************** PP TTEEEEEEES CS xxxxxxxxxx RF SET 153 kGeEltidYg 162 G Elt+dY+ gi|197313748|ref|NP_054878.5| 1658 SGSELTFDYQ 1667 *********6 PP == domain 3 score: -7.6 bits; conditional E-value: 4 E CS x RF SET 97 t 97 gi|197313748|ref|NP_054878.5| 1971 E 1971 1 PP >> WW WW domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.8 0.1 3.2 1.2e+04 2 15 .. 1457 1468 .. 1457 1468 .. 0.76 2 ! 38.3 2.0 2.2e-13 8.2e-10 1 31 [] 2391 2420 .. 2391 2420 .. 0.92 Alignments for each domain: == domain 1 score: -3.8 bits; conditional E-value: 3.2 --TEEEEE.ESTT- CS WW 2 ppgWeersddddGr 15 p+ W+e+ ++ G+ gi|197313748|ref|NP_054878.5| 1457 PQRWKECA-KQ-GK 1468 566***99.78.75 PP == domain 2 score: 38.3 bits; conditional E-value: 2.2e-13 ---TEE.EEE.ESTT-EEEEETTT--EESS-- CS WW 1 lppgWe.ersddddGrvYYyNheTgetqWekP 31 lpp W+ +r+ ++ G++YYy+ +T++tqW++P gi|197313748|ref|NP_054878.5| 2391 LPPNWKtARD-PE-GKIYYYHVITRQTQWDPP 2420 7999**7777.89.*****************9 PP >> Med26 TFIIS helical bundle-like domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 3.5 0.1 0.013 48 1 21 [. 1799 1820 .. 1799 1826 .. 0.93 2 ? 7.1 0.1 0.00096 3.5 33 51 .. 2001 2019 .. 1993 2020 .. 0.86 3 ? -4.3 0.0 3.5 1.3e+04 32 44 .. 2500 2512 .. 2494 2513 .. 0.81 Alignments for each domain: == domain 1 score: 3.5 bits; conditional E-value: 0.013 HHHHHHTTS-..STTHHHHHHH CS Med26 1 elLkvLkklp.itlelLkeTgi 21 e++k+L+ lp +t+ +L+e+++ gi|197313748|ref|NP_054878.5| 1799 EIIKTLEHLPiPTKNMLEESKV 1820 699*******99********97 PP == domain 2 score: 7.1 bits; conditional E-value: 0.00096 S-TTHHHHHHHHHHHHHHH CS Med26 33 eneevrklAkkLikkWkri 51 ++ ++++lA+kL++ Wk++ gi|197313748|ref|NP_054878.5| 2001 KTVDISDLATKLLDSWKDL 2019 7889*************85 PP == domain 3 score: -4.3 bits; conditional E-value: 3.5 .S-TTHHHHHHHH CS Med26 32 teneevrklAkkL 44 t++e+ ++lA+kL gi|197313748|ref|NP_054878.5| 2500 TTTEDFKHLARKL 2512 7899999****98 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (2564 residues) Target model(s): 14831 (2610332 nodes) Passed MSV filter: 1158 (0.0780797); expected 296.6 (0.02) Passed bias filter: 122 (0.00822601); expected 296.6 (0.02) Passed Vit filter: 30 (0.00202279); expected 14.8 (0.001) Passed Fwd filter: 4 (0.000269705); expected 0.1 (1e-05) Initial search space (Z): 14831 [actual number of targets] Domain search space (domZ): 4 [number of targets reported over threshold] # CPU time: 0.99u 0.22s 00:00:01.21 Elapsed: 00:00:00.30 # Mc/sec: 22309.64 // Query: gi|40068481|ref|NP_115609.2| [L=594] Description: histone-lysine N-methyltransferase setd3 isoform a [Homo sapiens] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-37 128.2 0.1 3.7e-37 127.0 0.1 1.7 1 Rubis-subs-bind Rubisco LSMT substrate-binding 4.3e-12 46.6 0.1 2.3e-11 44.2 0.0 2.3 3 SET SET domain ------ inclusion threshold ------ 0.14 11.8 0.0 0.3 10.8 0.0 1.5 1 Pertussis_S2S3 Pertussis toxin, subunit 2 and 3, C-terminal Domain annotation for each model (and alignments): >> Rubis-subs-bind Rubisco LSMT substrate-binding # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 127.0 0.1 7.6e-41 3.7e-37 1 128 [] 343 475 .. 343 475 .. 0.98 Alignments for each domain: == domain 1 score: 127.0 bits; conditional E-value: 7.6e-41 --TTSTTHHHHHHHHHTTT--SEEEEEEETTS-.--TTHHHHHHHHH-CGGGGGGGSGGGTTTHH....HHHHH---HHHH CS Rubis-subs-bind 1 lsendpladdKaqllerlglsetetftlrlngp.iskeLLaylRllllkeeelkelkslaesavi....stkeaplskenE 76 +s++d+l+++Ka++l+r+g++++++f l++++p is++LLa+lR+++++eeelke++ +++ ++ e+p+s++nE gi|40068481|ref|NP_115609.2| 343 VSKSDRLYAMKAEVLARAGIPTSSVFALHFTEPpISAQLLAFLRVFCMTEEELKEHLLGDSAIDRiftlGNSEFPVSWDNE 423 689******************************************************999999989*************** PP HHHHHHHHHHHHHHHTTSSS-HHHHHHH.HTS---HHHHHHHHHHHHHHHHH CS Rubis-subs-bind 77 ekvlqvladlcaeaLseypttleeDeallkkadleeqkrlavrlRlgEKrIL 128 k++ +l+d+ ++L+ y+tt+eeD+ lk+ dl+ ++ +a++lRlgEK+IL gi|40068481|ref|NP_115609.2| 424 VKLWTFLEDRASLLLKTYKTTIEEDKSVLKNHDLSVRAKMAIKLRLGEKEIL 475 ***************************************************9 PP >> SET SET domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.4 0.0 1 5e+03 55 102 .. 4 51 .. 2 56 .. 0.87 2 ! 44.2 0.0 4.6e-15 2.3e-11 1 162 [] 105 314 .. 105 314 .. 0.72 3 ? -2.3 0.0 0.93 4.6e+03 60 106 .. 452 498 .. 390 519 .. 0.65 Alignments for each domain: == domain 1 score: -2.4 bits; conditional E-value: 1 HHHHHHHHTHHHHHHH.TTTS.GGG..HHHHHHHHHHHHHH.EEETTS CS xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF SET 55 skrqkagksvrspaalsarsgalksalaasvdasesaaepkatedeye 102 + r k++ks ++ a+ ++ l+ + + ++ s++a++p+ ++ey gi|40068481|ref|NP_115609.2| 4 KSRVKTQKSGTGATATVSPKEILNLTSELLQKCSSPAPGPGKEWEEYV 51 568899999999999999999999999999999999999999998875 PP == domain 2 score: 44.2 bits; conditional E-value: 4.6e-15 SEEEEESS-B-TTEEEE.EECCEEEECCCCHH................................................. CS xxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxx................................................. RF SET 1 GrGvrAtedIpkgefvc.eyvgelltddeaek................................................. 31 G+G+rAt+dI++ e+ + +++ l+t ++a++ gi|40068481|ref|NP_115609.2| 105 GFGLRATRDIKAEELFLwVPRKLLMTVESAKNsvlgplysqdrilqamgnialafhllceraspnsfwqpyiqtlpseydt 185 9*************7779***********************************9999999999999999988888888888 PP .....HHHHHHHHHHC.TTCCTCEHHHHHHHHHHTHHHHHHH.TTTS.GGG..HHHHHHHHHHHHHH.EEETTSSCEEEEE CS ...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF SET 32 ...kpelerldlskaleaasralaakskrqkagksvrspaalsarsgalksalaasvdasesaaepkatedeyeeeeseyv 109 e+e+++l+++++ ++ +++ ++ + ++ ++ +++++++ + +d + + ++a+++ +++ + + gi|40068481|ref|NP_115609.2| 186 plyFEEDEVRYLQSTQAIHDVFSQ------YKNTARQYAYFYKVIQTHPHANKLPLKDSFTYEDYRWAVSSVMTRQNQIPT 260 888434444444444444444444......333344444444444455555555555555555555555555555555555 PP CEE....CCECCCGGGHEESSS.SEEEEEECSTTSSEEEEEESS-B-TTEEEEEEES CS xxx....xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF SET 110 ida....kllgnlarflNHSCdpNltvqavfvlrlprvaffAtrdIkkGeEltidYg 162 d+ +l++l++++NH l + ++ l+++r + +A++d ++Ge+++i Yg gi|40068481|ref|NP_115609.2| 261 EDGsrvtLALIPLWDMCNHTN--GLITTGYN-LEDDRCECVALQDFRAGEQIYIFYG 314 5541111689*********88..44444433.89**********************8 PP == domain 3 score: -2.3 bits; conditional E-value: 0.93 HHHTHHHHHHH.TTTS.GGG..HHHHHHHHHHHHHH.EEETTSSCEE CS xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF SET 60 agksvrspaalsarsgalksalaasvdasesaaepkatedeyeeees 106 ++ ++s +a+ a + l + +++ ++a +++++++++ee ++ gi|40068481|ref|NP_115609.2| 452 LKNHDLSVRAKMAIKLRLGEKEILEKAVKSAAVNREYYRQQMEEKAP 498 34444444444444444444444455555555555555555555554 PP >> Pertussis_S2S3 Pertussis toxin, subunit 2 and 3, C-terminal domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 10.8 0.0 6.1e-05 0.3 41 86 .. 32 79 .. 27 100 .. 0.75 Alignments for each domain: == domain 1 score: 10.8 bits; conditional E-value: 6.1e-05 EEEEEE-SSS..STTSTTHHHHHHHHHHHHHHT-EEEEEEEEEEEE-- CS Pertussis_S2S3 41 vigacisPye..GryresyatlrrllellyvaGlavrvyvskeeryyd 86 +++ c sP G+ +e y ++r l+e ++++ + v + +++ y+ gi|40068481|ref|NP_115609.2| 32 LLQKCSSPAPgpGKEWEEYVQIRTLVEKIRKKQKGLSVTFDGKREDYF 79 67899998752268***************9876666666665555554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (594 residues) Target model(s): 14831 (2610332 nodes) Passed MSV filter: 443 (0.0298699); expected 296.6 (0.02) Passed bias filter: 287 (0.0193514); expected 296.6 (0.02) Passed Vit filter: 21 (0.00141595); expected 14.8 (0.001) Passed Fwd filter: 3 (0.000202279); expected 0.1 (1e-05) Initial search space (Z): 14831 [actual number of targets] Domain search space (domZ): 3 [number of targets reported over threshold] # CPU time: 0.39u 0.25s 00:00:00.64 Elapsed: 00:00:00.24 # Mc/sec: 6460.57 // Query: gi|40068483|ref|NP_954574.1| [L=296] Description: histone-lysine N-methyltransferase setd3 isoform b [Homo sapiens] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-07 32.0 0.0 6.4e-07 29.8 0.0 2.0 2 SET SET domain ------ inclusion threshold ------ 0.054 13.2 0.0 0.1 12.3 0.0 1.4 1 Pertussis_S2S3 Pertussis toxin, subunit 2 and 3, C-terminal Domain annotation for each model (and alignments): >> SET SET domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.9 0.0 0.23 1.7e+03 55 102 .. 4 51 .. 2 59 .. 0.87 2 ! 29.8 0.0 8.6e-11 6.4e-07 1 126 [. 105 281 .. 105 292 .. 0.70 Alignments for each domain: == domain 1 score: -0.9 bits; conditional E-value: 0.23 HHHHHHHHTHHHHHHH.TTTS.GGG..HHHHHHHHHHHHHH.EEETTS CS xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF SET 55 skrqkagksvrspaalsarsgalksalaasvdasesaaepkatedeye 102 + r k++ks ++ a+ ++ l+ + + ++ s++a++p+ ++ey gi|40068483|ref|NP_954574.1| 4 KSRVKTQKSGTGATATVSPKEILNLTSELLQKCSSPAPGPGKEWEEYV 51 568899999999999999999999999999999999999999999886 PP == domain 2 score: 29.8 bits; conditional E-value: 8.6e-11 SEEEEESS-B-TTEEEE.EECCEEEECCCCHH................................................. CS xxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxx................................................. RF SET 1 GrGvrAtedIpkgefvc.eyvgelltddeaek................................................. 31 G+G+rAt+dI++ e+ + +++ l+t ++a++ gi|40068483|ref|NP_954574.1| 105 GFGLRATRDIKAEELFLwVPRKLLMTVESAKNsvlgplysqdrilqamgnialafhllceraspnsfwqpyiqtlpseydt 185 9*************7779********************************9999999999999999999988888888888 PP .....HHHHHHHHHHC.TTCCTCEHHHHHHHHHHTHHHHHHH.TTTS.GGG..HHHHHHHHHHHHHH.EEETTSSCEEEEE CS ...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF SET 32 ...kpelerldlskaleaasralaakskrqkagksvrspaalsarsgalksalaasvdasesaaepkatedeyeeeeseyv 109 e+e+++l+++++ ++ +++ ++ + ++ ++ +++++++ + +d + + ++a+++ +++ + + gi|40068483|ref|NP_954574.1| 186 plyFEEDEVRYLQSTQAIHDVFSQ------YKNTARQYAYFYKVIQTHPHANKLPLKDSFTYEDYRWAVSSVMTRQNQIPT 260 888434444444444444444444......333344444444444455555555555555555555555555555555555 PP CEE....CCECCCGGGHEESS CS xxx....xxxxxxxxxxxxxx RF SET 110 ida....kllgnlarflNHSC 126 d+ +l++l++++NH gi|40068483|ref|NP_954574.1| 261 EDGsrvtLALIPLWDMCNHTN 281 5541111689*********75 PP >> Pertussis_S2S3 Pertussis toxin, subunit 2 and 3, C-terminal domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 12.3 0.0 1.4e-05 0.1 41 86 .. 32 79 .. 27 101 .. 0.74 Alignments for each domain: == domain 1 score: 12.3 bits; conditional E-value: 1.4e-05 EEEEEE-SSS..STTSTTHHHHHHHHHHHHHHT-EEEEEEEEEEEE-- CS Pertussis_S2S3 41 vigacisPye..GryresyatlrrllellyvaGlavrvyvskeeryyd 86 +++ c sP G+ +e y ++r l+e ++++ + v + +++ y+ gi|40068483|ref|NP_954574.1| 32 LLQKCSSPAPgpGKEWEEYVQIRTLVEKIRKKQKGLSVTFDGKREDYF 79 67899998752268***************9876666666665555554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (296 residues) Target model(s): 14831 (2610332 nodes) Passed MSV filter: 396 (0.0267008); expected 296.6 (0.02) Passed bias filter: 346 (0.0233295); expected 296.6 (0.02) Passed Vit filter: 30 (0.00202279); expected 14.8 (0.001) Passed Fwd filter: 2 (0.000134853); expected 0.1 (1e-05) Initial search space (Z): 14831 [actual number of targets] Domain search space (domZ): 2 [number of targets reported over threshold] # CPU time: 0.32u 0.27s 00:00:00.59 Elapsed: 00:00:00.25 # Mc/sec: 3090.63 // Query: gi|22328112|gb|AAH36556.1| [L=416] Description: SETD4 protein [Homo sapiens] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-23 81.4 0.2 7.9e-23 80.7 0.2 1.4 1 Rubis-subs-bind Rubisco LSMT substrate-binding 9.4e-11 42.2 0.0 2.9e-10 40.6 0.0 1.9 1 SET SET domain Domain annotation for each model (and alignments): >> Rubis-subs-bind Rubisco LSMT substrate-binding # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 80.7 0.2 1.1e-26 7.9e-23 1 128 [] 283 401 .. 283 401 .. 0.99 Alignments for each domain: == domain 1 score: 80.7 bits; conditional E-value: 1.1e-26 --TTSTTHHHHHHHHHTTT--SEEEEEEETTS---TTHHHHHHHHH-CGGGGGGGSGGGTTTHHHHHHH---HHHHHHHHHHH CS Rubis-subs-bind 1 lsendpladdKaqllerlglsetetftlrlngpiskeLLaylRllllkeeelkelkslaesavistkeaplskenEekvlqvl 83 l++ d+++d+K ++l+++g e+ +t++++gp s++LL++l+ll+l++e+++++k++ ++ vi s+ nE+++l+++ gi|22328112|gb|AAH36556.1| 283 LPSTDKQMDKKISILKDHGYIEN--LTFGWDGP-SWRLLTALKLLCLEAEKFTCWKKVLLGEVI-------SDTNEKTSLDIA 355 6889*******************..********.******************************.......************ PP HHHHHHHHTTSSS-HHH.HHHH.HTS---HHHHHHHHHHHHHHHHH CS Rubis-subs-bind 84 adlcaeaLseypttlee.DeallkkadleeqkrlavrlRlgEKrIL 128 +++c +++e++ l++ ++++ +k+ l +q++l+++l+++E +IL gi|22328112|gb|AAH36556.1| 356 QKICYYFIEETNAVLQKvSHMKDEKEALINQLTLVESLWTEELKIL 401 *********************************************9 PP >> SET SET domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 40.6 0.0 3.9e-14 2.9e-10 1 162 [] 35 249 .. 35 249 .. 0.81 Alignments for each domain: == domain 1 score: 40.6 bits; conditional E-value: 3.9e-14 SEEEEESS-B-TTEEEE.EECCEEEECCCCHH................................................... CS xxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxx................................................... RF SET 1 GrGvrAtedIpkgefvc.eyvgelltddeaek................................................... 31 GrG+++ + +++g++++ + + llt+d++ + gi|22328112|gb|AAH36556.1| 35 GRGLMSQTSLQEGQMIIsLPESCLLTTDTVIRsylgayitkwkpppspllalctflvsekhaghrslwkpyleilpkaytcpv 117 9********************************************************99999999999999999999999999 PP .................HHHHHHHHHHC.TTCCTCEHHHHHHHHHHTHHHHHHH.TTTS.GGG..HHHHHHHHHHHHHH.EEE CS ...............xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF SET 32 ...............kpelerldlskaleaasralaakskrqkagksvrspaalsarsgalksalaasvdasesaaepkated 99 +a+++++ +q+ s r++ + a++ + s+ a a ++ +t+ gi|22328112|gb|AAH36556.1| 118 clepevvnllpkslkA------------KAEEQRA----HVQEFFASSRDFFSSLQPLFAEAVDSIFSYSALLWAWCTVNTRA 184 9876665543333221............2222222....35666667777777777777777777777777777777777777 PP TTSSCEEEE....ECEECCECCCGGGHEESSS.SEEEEEECSTTSSEEEEEESS-B-TTEEEEEEES CS xxxxxxxxx....xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF SET 100 eyeeeesey....vidakllgnlarflNHSCdpNltvqavfvlrlprvaffAtrdIkkGeEltidYg 162 y ++ + + d +l ++ ++lNHS + v+a f ++ +++++t + +k eE++i+Yg gi|22328112|gb|AAH36556.1| 185 VYLRPRQREclsaEPDTCALAPYLDLLNHSP--HVQVKAAFNEETHSYEIRTTSRWRKHEEVFICYG 249 666666554112278999***********99..999999999************************8 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (416 residues) Target model(s): 14831 (2610332 nodes) Passed MSV filter: 642 (0.0432877); expected 296.6 (0.02) Passed bias filter: 470 (0.0316904); expected 296.6 (0.02) Passed Vit filter: 38 (0.0025622); expected 14.8 (0.001) Passed Fwd filter: 2 (0.000134853); expected 0.1 (1e-05) Initial search space (Z): 14831 [actual number of targets] Domain search space (domZ): 2 [number of targets reported over threshold] # CPU time: 0.31u 0.35s 00:00:00.65 Elapsed: 00:00:00.27 # Mc/sec: 4021.84 // Query: gi|18089236|gb|AAH20956.1| [L=924] Description: SETD5 protein [Homo sapiens] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (924 residues) Target model(s): 14831 (2610332 nodes) Passed MSV filter: 587 (0.0395793); expected 296.6 (0.02) Passed bias filter: 207 (0.0139573); expected 296.6 (0.02) Passed Vit filter: 19 (0.0012811); expected 14.8 (0.001) Passed Fwd filter: 1 (6.74263e-05); expected 0.1 (1e-05) Initial search space (Z): 14831 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.51u 0.25s 00:00:00.76 Elapsed: 00:00:00.25 # Mc/sec: 9647.79 // Query: gi|238550107|ref|NP_001153777.1| [L=473] Description: N-lysine methyltransferase SETD6 isoform a [Homo sapiens] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-23 82.6 0.0 6.4e-23 81.8 0.0 1.4 1 SET SET domain 2.3e-08 33.9 0.5 4.7e-08 33.0 0.4 1.5 1 Rubis-subs-bind Rubisco LSMT substrate-binding Domain annotation for each model (and alignments): >> SET SET domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 81.8 0.0 8.7e-27 6.4e-23 1 162 [] 74 286 .. 74 286 .. 0.87 Alignments for each domain: == domain 1 score: 81.8 bits; conditional E-value: 8.7e-27 SEEEEESS-B-TTEEEE.EECCEEEECCCCHH..............................HHHHHHHHHHC.TTC CS xxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxx............................xxxxxxxxxxxxxxxxx RF SET 1 GrGvrAtedIpkgefvc.eyvgelltddeaek............................kpelerldlskaleaas 48 G+G++A+e +++ge+++ +++ +ll++++++ + + as gi|238550107|ref|NP_001153777.1| 74 GYGMVARESVQAGELLFvVPRAALLSQHTCSIggllerervalqsqsgwvplllallhelQ------------APAS 138 9*************999*****************999999999999996655555544440............4444 PP CTCE......................................HHHHHHHHHHTHHHHHHH.TTTS.GGG..HHHHHH CS xxxx......................................xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF SET 49 rala......................................akskrqkagksvrspaalsarsgalksalaasvda 87 r+ + + r++ + v+ +++ + + +l+ + + +++ gi|238550107|ref|NP_001153777.1| 139 RWRPyfalwpelgrlehpmfwpeeerrcllqgtgvpeavekdLANIRSEYQSIVLPFMEAHPDLFSLRVRSLELYHQ 215 4444555566666666666666666777788888888888888899999**************************** PP HHHHHHHH.EEETTSSCEEEEECEECCECCCGGGHEESSS.SEEEEEECSTTSSEEEEEESS-B-TTEEEEEEES CS xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF SET 88 sesaaepkatedeyeeeeseyvidakllgnlarflNHSCdpNltvqavfvlrlprvaffAtrdIkkGeEltidYg 162 + ++ ++++ eeee+e++ ++ ++++ a++lNH ++N++++++ +++ ++At++I+kG E++++Yg gi|238550107|ref|NP_001153777.1| 216 LVALVMAYSFQEPLEEEEDEKEPNSPVMVPAADILNHLANHNANLEYS----ANCLRMVATQPIPKGHEIFNTYG 286 ***************************************99******8....9*********************8 PP >> Rubis-subs-bind Rubisco LSMT substrate-binding # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 33.0 0.4 6.3e-12 4.7e-08 7 128 .] 334 465 .. 329 465 .. 0.83 Alignments for each domain: == domain 1 score: 33.0 bits; conditional E-value: 6.3e-12 THHHHHHHHHTTT--SE.EEEEEETTS-...--TTHHHHHHHHH-CGGGGGGGSGGGTTTHHHHHHH---HHH.... CS Rubis-subs-bind 7 laddKaqllerlglset.etftlrlngp...iskeLLaylRllllkeeelkelkslaesavistkeaplsken.... 75 l+ ++++ l +l++ + + f +++++ + eL + l++l++ +ee++elk ++ + + +e l n gi|238550107|ref|NP_001153777.1| 334 LVYERWDFLCKLEMVGEeGAF--VIGREevlTEEELTTTLKVLCMPAEEFRELKDQDGGGDDKREEGSLTITNipkl 408 556778888888888884555..555555599******************************666666666666666 PP HHHHHHHHHHHHHHHHTTSSS-HHHHHHH.HTS---HH....HHHHHHHHHHHHHHH CS Rubis-subs-bind 76 EekvlqvladlcaeaLseypttleeDeallkkadleeq....krlavrlRlgEKrIL 128 + +q+l++++ ++L+ y t l+ D++ll + + + ++ a+++R g K IL gi|238550107|ref|NP_001153777.1| 409 KASWRQLLQNSVLLTLQTYATDLKTDQGLLSNKEVYAKlswrEQQALQVRYGQKMIL 465 99999*************************996655555666*************98 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (473 residues) Target model(s): 14831 (2610332 nodes) Passed MSV filter: 305 (0.020565); expected 296.6 (0.02) Passed bias filter: 251 (0.016924); expected 296.6 (0.02) Passed Vit filter: 17 (0.00114625); expected 14.8 (0.001) Passed Fwd filter: 2 (0.000134853); expected 0.1 (1e-05) Initial search space (Z): 14831 [actual number of targets] Domain search space (domZ): 2 [number of targets reported over threshold] # CPU time: 0.28u 0.19s 00:00:00.47 Elapsed: 00:00:00.18 # Mc/sec: 6859.37 // Query: gi|238550105|ref|NP_079136.2| [L=449] Description: N-lysine methyltransferase SETD6 isoform b [Homo sapiens] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-23 82.8 0.0 5.7e-23 82.0 0.0 1.4 1 SET SET domain 2.1e-08 34.1 0.5 4.2e-08 33.1 0.4 1.5 1 Rubis-subs-bind Rubisco LSMT substrate-binding Domain annotation for each model (and alignments): >> SET SET domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 82.0 0.0 7.6e-27 5.7e-23 1 162 [] 50 262 .. 50 262 .. 0.87 Alignments for each domain: == domain 1 score: 82.0 bits; conditional E-value: 7.6e-27 SEEEEESS-B-TTEEEE.EECCEEEECCCCHH..............................HHHHHHHHHHC.TTCCTC CS xxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxx............................xxxxxxxxxxxxxxxxxxxx RF SET 1 GrGvrAtedIpkgefvc.eyvgelltddeaek............................kpelerldlskaleaasral 51 G+G++A+e +++ge+++ +++ +ll++++++ + + asr+ gi|238550105|ref|NP_079136.2| 50 GYGMVARESVQAGELLFvVPRAALLSQHTCSIggllerervalqsqsgwvplllallhelQ------------APASRWR 117 9*************999*****************999999999999996655555544440............4444444 PP E......................................HHHHHHHHHHTHHHHHHH.TTTS.GGG..HHHHHHHHHHHH CS x......................................xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF SET 52 a......................................akskrqkagksvrspaalsarsgalksalaasvdasesaae 93 + + r++ + v+ +++ + + +l+ + + +++ + + gi|238550105|ref|NP_079136.2| 118 PyfalwpelgrlehpmfwpeeerrcllqgtgvpeavekdLANIRSEYQSIVLPFMEAHPDLFSLRVRSLELYHQLVALVM 197 4555566666666666666666777788888888888888899999********************************** PP HH.EEETTSSCEEEEECEECCECCCGGGHEESSS.SEEEEEECSTTSSEEEEEESS-B-TTEEEEEEES CS xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF SET 94 pkatedeyeeeeseyvidakllgnlarflNHSCdpNltvqavfvlrlprvaffAtrdIkkGeEltidYg 162 + ++++ eeee+e++ ++ ++++ a++lNH ++N++++++ +++ ++At++I+kG E++++Yg gi|238550105|ref|NP_079136.2| 198 AYSFQEPLEEEEDEKEPNSPVMVPAADILNHLANHNANLEYS----ANCLRMVATQPIPKGHEIFNTYG 262 *********************************99******8....9*********************8 PP >> Rubis-subs-bind Rubisco LSMT substrate-binding # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 33.1 0.4 5.7e-12 4.2e-08 7 128 .] 310 441 .. 305 441 .. 0.83 Alignments for each domain: == domain 1 score: 33.1 bits; conditional E-value: 5.7e-12 THHHHHHHHHTTT--SE.EEEEEETTS-...--TTHHHHHHHHH-CGGGGGGGSGGGTTTHHHHHHH---HHH....HHH CS Rubis-subs-bind 7 laddKaqllerlglset.etftlrlngp...iskeLLaylRllllkeeelkelkslaesavistkeaplsken....Eek 78 l+ ++++ l +l++ + + f +++++ + eL + l++l++ +ee++elk ++ + + +e l n + gi|238550105|ref|NP_079136.2| 310 LVYERWDFLCKLEMVGEeGAF--VIGREevlTEEELTTTLKVLCMPAEEFRELKDQDGGGDDKREEGSLTITNipklKAS 387 556788888888888884555..555555599******************************666666666666666999 PP HHHHHHHHHHHHHTTSSS-HHHHHHH.HTS---HH....HHHHHHHHHHHHHHH CS Rubis-subs-bind 79 vlqvladlcaeaLseypttleeDeallkkadleeq....krlavrlRlgEKrIL 128 +q+l++++ ++L+ y t l+ D++ll + + + ++ a+++R g K IL gi|238550105|ref|NP_079136.2| 388 WRQLLQNSVLLTLQTYATDLKTDQGLLSNKEVYAKlswrEQQALQVRYGQKMIL 441 99*************************996655555666*************98 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (449 residues) Target model(s): 14831 (2610332 nodes) Passed MSV filter: 283 (0.0190817); expected 296.6 (0.02) Passed bias filter: 239 (0.0161149); expected 296.6 (0.02) Passed Vit filter: 16 (0.00107882); expected 14.8 (0.001) Passed Fwd filter: 2 (0.000134853); expected 0.1 (1e-05) Initial search space (Z): 14831 [actual number of targets] Domain search space (domZ): 2 [number of targets reported over threshold] # CPU time: 0.27u 0.21s 00:00:00.48 Elapsed: 00:00:00.19 # Mc/sec: 6168.63 // Query: gi|25091217|sp|Q8WTS6.1|SETD7_HUMAN [L=366] Description: RecName: Full=Histone-lysine N-methyltransferase SETD7; AltName: Full=Histone H3-K4 methyltransferase SETD7; Short=H3-K4-HMTase SETD7; AltName: Full=Lysine N-methyltransferase 7; AltName: Full=SET domain-containing protein 7; AltName: Full=SET7/9 Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.6e-15 53.4 18.8 0.0013 18.3 0.6 5.8 5 MORN MORN repeat 4.9e-07 30.1 0.0 2.9e-06 27.6 0.0 2.1 1 SET SET domain 0.0022 17.8 6.2 0.15 12.1 0.0 4.1 4 MORN_2 MORN repeat variant Domain annotation for each model (and alignments): >> MORN MORN repeat # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 5.8 0.0 0.0025 12 7 22 .. 19 34 .. 13 35 .. 0.85 2 ! 17.6 0.8 4.3e-07 0.0021 1 23 [] 36 58 .. 36 58 .. 0.96 3 ! 17.8 0.2 3.8e-07 0.0019 2 23 .] 60 81 .. 60 81 .. 0.95 4 ? 3.1 0.0 0.018 87 2 21 .. 83 102 .. 83 103 .. 0.89 5 ! 18.3 0.6 2.6e-07 0.0013 1 22 [. 106 127 .. 106 128 .. 0.94 Alignments for each domain: == domain 1 score: 5.8 bits; conditional E-value: 0.0025 TTEEESEEEEE-TTS- CS MORN 7 nGkrhGkGvytwpdGd 22 +G++hG+++ t+++ d gi|25091217|sp|Q8WTS6.1|SETD7_HUMAN 19 DGLPHGFCTVTYSSTD 34 8*********998755 PP == domain 2 score: 17.6 bits; conditional E-value: 4.3e-07 EEEEEETTEEESEEEEE-TTS-E CS MORN 1 YeGeWknGkrhGkGvytwpdGdr 23 +eG++++G ++G G++ + dG++ gi|25091217|sp|Q8WTS6.1|SETD7_HUMAN 36 FEGNFVHGEKNGRGKFFFFDGST 58 79*******************86 PP == domain 3 score: 17.8 bits; conditional E-value: 3.8e-07 EEEEETTEEESEEEEE-TTS-E CS MORN 2 eGeWknGkrhGkGvytwpdGdr 23 eG ++++ +G+Gvyt+ dG++ gi|25091217|sp|Q8WTS6.1|SETD7_HUMAN 60 EGYYVDDALQGQGVYTYEDGGV 81 89******************85 PP == domain 4 score: 3.1 bits; conditional E-value: 0.018 EEEEETTEEESEEEEE-TTS CS MORN 2 eGeWknGkrhGkGvytwpdG 21 +G++++G +G ++ dG gi|25091217|sp|Q8WTS6.1|SETD7_HUMAN 83 QGTYVDGELNGPAQEYDTDG 102 7**********998888887 PP == domain 5 score: 18.3 bits; conditional E-value: 2.6e-07 EEEEEETTEEESEEEEE-TTS- CS MORN 1 YeGeWknGkrhGkGvytwpdGd 22 + G++k++ rhG ++ ++pdG+ gi|25091217|sp|Q8WTS6.1|SETD7_HUMAN 106 FKGQYKDNIRHGVCWIYYPDGG 127 68*******************8 PP >> SET SET domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 27.6 0.0 5.9e-10 2.9e-06 3 162 .] 229 336 .. 227 336 .. 0.72 Alignments for each domain: == domain 1 score: 27.6 bits; conditional E-value: 5.9e-10 EEEESS-B-TTEEEE.EECCEEEECCCCHH..HHHHHHHHHHC.TTCCTCEHHHHHHHHHHTHHHHHHH.TTTS CS xxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF SET 3 GvrAtedIpkgefvc.eyvgelltddeaekkpelerldlskaleaasralaakskrqkagksvrspaalsarsg 75 G++++ + +++ v+ y g +t++e++++ + al+ + +l+ gi|25091217|sp|Q8WTS6.1|SETD7_HUMAN 229 GLFSKVAVGPNT-VMsFYNGVRITHQEVDSR--------DWALNGNTLSLD----------------------- 270 566666666666.333666666666666662........233334444444....................... PP .GGG..HHHHHHHHHHHHHH.EEETTSSCEEEEECEECCECCCGGGHEESSS.SEEEEEECS.TTSSEEEEEES CS xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxx RF SET 76 alksalaasvdasesaaepkatedeyeeeeseyvidakllgnlarflNHSCdpNltvqavfv.lrlprvaffAt 148 e+ + + y+ +k + l++ NHS +pN+ ++ + + +p +++++ gi|25091217|sp|Q8WTS6.1|SETD7_HUMAN 271 ----------------------EETVIDVPEPYNHVSKYCASLGHKANHSFTPNCIYDMFVHpRFGPIKCIRTL 322 ......................4555566667777889999****************986669999999***** PP S-B-TTEEEEEEES CS xxxxxxxxxxxxxx RF SET 149 rdIkkGeEltidYg 162 r ++++eElt+ Yg gi|25091217|sp|Q8WTS6.1|SETD7_HUMAN 323 RAVEADEELTVAYG 336 *************8 PP >> MORN_2 MORN repeat variant # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.0 0.1 0.54 2.7e+03 1 14 [. 45 58 .. 45 65 .. 0.70 2 ? -1.2 0.0 0.65 3.2e+03 9 20 .. 76 86 .. 68 88 .. 0.62 3 ! 12.1 0.0 3e-05 0.15 1 22 [] 91 112 .. 91 112 .. 0.96 4 ! 6.0 0.0 0.0029 14 1 12 [. 115 126 .. 115 127 .. 0.94 Alignments for each domain: == domain 1 score: -1.0 bits; conditional E-value: 0.54 MORN_2 1 leGeekeYyenGkl 14 ++G k+++ +G gi|25091217|sp|Q8WTS6.1|SETD7_HUMAN 45 KNGRGKFFFFDGST 58 68889999988865 PP == domain 2 score: -1.2 bits; conditional E-value: 0.65 MORN_2 9 yenGklkseitY 20 ye+G + ++tY gi|25091217|sp|Q8WTS6.1|SETD7_HUMAN 76 YEDGGVL-QGTY 86 5666555.4555 PP == domain 3 score: 12.1 bits; conditional E-value: 3e-05 MORN_2 1 leGeekeYyenGklkseitYkn 22 l+G ++eY+ +G l +++Yk+ gi|25091217|sp|Q8WTS6.1|SETD7_HUMAN 91 LNGPAQEYDTDGRLIFKGQYKD 112 69*******************7 PP == domain 4 score: 6.0 bits; conditional E-value: 0.0029 MORN_2 1 leGeekeYyenG 12 ++G+ Yy++G gi|25091217|sp|Q8WTS6.1|SETD7_HUMAN 115 RHGVCWIYYPDG 126 79*********9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (366 residues) Target model(s): 14831 (2610332 nodes) Passed MSV filter: 245 (0.0165195); expected 296.6 (0.02) Passed bias filter: 232 (0.0156429); expected 296.6 (0.02) Passed Vit filter: 20 (0.00134853); expected 14.8 (0.001) Passed Fwd filter: 3 (0.000202279); expected 0.1 (1e-05) Initial search space (Z): 14831 [actual number of targets] Domain search space (domZ): 3 [number of targets reported over threshold] # CPU time: 0.24u 0.18s 00:00:00.42 Elapsed: 00:00:00.17 # Mc/sec: 5619.89 // Query: gi|143811459|sp|Q96T68.2|SETB2_HUMAN [L=719] Description: RecName: Full=Histone-lysine N-methyltransferase SETDB2; AltName: Full=Chronic lymphocytic leukemia deletion region gene 8 protein; AltName: Full=Lysine N-methyltransferase 1F; AltName: Full=SET domain bifurcated 2 Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-27 97.3 3.5 1.1e-27 97.3 2.5 2.7 3 SET SET domain 2.1e-17 63.2 7.9 2.1e-17 63.2 5.4 3.5 5 Pre-SET Pre-SET motif 1.7e-07 30.6 0.1 5.5e-07 29.0 0.0 1.9 2 MBD Methyl-CpG binding domain Domain annotation for each model (and alignments): >> SET SET domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.1 0.0 0.8 4e+03 79 96 .. 70 87 .. 39 148 .. 0.62 2 ? -1.8 0.1 0.66 3.3e+03 90 130 .. 257 295 .. 250 314 .. 0.77 3 ! 97.3 2.5 2.3e-31 1.1e-27 1 162 [] 378 694 .. 378 694 .. 0.87 Alignments for each domain: == domain 1 score: -2.1 bits; conditional E-value: 0.8 G..HHHHHHHHHHHHHH. CS xxxxxxxxxxxxxxxxxx RF SET 79 salaasvdasesaaepka 96 a + +v+a++s ++p + gi|143811459|sp|Q96T68.2|SETB2_HUMAN 70 GASQKEVNAQSSDPMPVT 87 333333333333333333 PP == domain 2 score: -1.8 bits; conditional E-value: 0.66 HHHHHH.EEETTSSCEEEEECEECCECCCGGGHEESSS.SE CS xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF SET 90 saaepkatedeyeeeeseyvidakllgnlarflNHSCdpNl 130 + +e +++ +++ + + a l n+++++ SC + gi|143811459|sp|Q96T68.2|SETB2_HUMAN 257 FCNEIDSRKLPQFKYRKTVWPRAYNLTNFSSMFTDSC--DC 295 666777778888899999999999999********99..44 PP == domain 3 score: 97.3 bits; conditional E-value: 2.3e-31 SEEEEESS-B-TTEEEEEECCEEEECCCCHH.......................................... CS xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.......................................... RF SET 1 GrGvrAtedIpkgefvceyvgelltddeaek.......................................... 31 G+Gvr+++dI +g+fvc+y g+ll+ ++ ek gi|143811459|sp|Q96T68.2|SETB2_HUMAN 378 GWGVRCLDDIDRGTFVCIYSGRLLSRANTEKsygidengrdentmknifskkrklevacsdcevevlplglet 450 9************************************************************************ PP ......................................................................... CS ......................................................................... RF SET 32 ......................................................................... 31 gi|143811459|sp|Q96T68.2|SETB2_HUMAN 451 hprtaktekcppkfsnnpkeltvetkydnisriqyhsvirdpesktaifqhngkkmefvssesvtpedndgfk 523 ************************************************************************9 PP ..............................................HHHHHHHHHHC.TTCCTCE..HHHHHH CS ............................................xxxxxxxxxxxxxxxxxxxxx..xxxxxx RF SET 32 ............................................kpelerldlskaleaasrala..akskrq 58 p++ r++++++l++++ ++a ++ gi|143811459|sp|Q96T68.2|SETB2_HUMAN 524 pprehlnsktkgaqkdsssnhvdefednlliesdviditkyreeTPPRSRCNQATTLDNQNIKKAieVQIQKP 596 9999999999999999999999999999999999999999999977777888888888888888833222222 PP HHHHTHHHHHHH.TTTS.GGG..HHHHHHHHHHHHHH.EEETTSSCEEEEECEECCECCCGGGHEESSS.SEE CS xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF SET 59 kagksvrspaalsarsgalksalaasvdasesaaepkatedeyeeeeseyvidakllgnlarflNHSCdpNlt 131 g s+ + + + ++ + + + ++ +++ ++ + da+ +gn++rflNHSC pNl gi|143811459|sp|Q96T68.2|SETB2_HUMAN 597 QEGRSTACQRQQVFCDEE----------LLSETKNTSSDSLTKFNKGNVFLLDATKEGNVGRFLNHSCCPNLL 659 222222222222222222..........233344555667777888888889****************99*** PP EEEECS....TTSSEEEEEESS-B-TTEEEEEEES CS xxxxxx....xxxxxxxxxxxxxxxxxxxxxxxxx RF SET 132 vqavfv....lrlprvaffAtrdIkkGeEltidYg 162 vq+vfv +++p vaff+ r++k+ +Elt+dYg gi|143811459|sp|Q96T68.2|SETB2_HUMAN 660 VQNVFVethnRNFPLVAFFTNRYVKARTELTWDYG 694 **********************************8 PP >> Pre-SET Pre-SET motif # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.6 0.2 0.63 3.1e+03 42 67 .. 94 117 .. 30 152 .. 0.56 2 ! 63.2 5.4 4.3e-21 2.1e-17 1 103 [] 245 359 .. 245 359 .. 0.90 3 ? -2.5 0.0 1.2 6e+03 39 53 .. 426 453 .. 417 495 .. 0.53 4 ? -3.4 0.1 2.4 1.2e+04 41 41 .. 596 596 .. 564 626 .. 0.53 5 ? -0.2 0.0 0.23 1.1e+03 42 56 .. 700 715 .. 661 718 .. 0.71 Alignments for each domain: == domain 1 score: -1.6 bits; conditional E-value: 0.63 TCCC------TTGCTCTTTSGGGTTS CS Pre-SET 42 seeaesgCeCedecseeskCkClaea 67 +++a +Ce++ +++C+ l+++ gi|143811459|sp|Q96T68.2|SETB2_HUMAN 94 KSNAFPSTSCENS--FPEDCTFLTTE 117 2222223344442..35555555544 PP == domain 2 score: 63.2 bits; conditional E-value: 4.3e-21 HCCCTSSSS-EEEESSSST---STTSEE-SS-EE-TTSS.-TTCCC------TTGCTCTTTSGGGTTS-S... CS Pre-SET 1 diskgkekvpipvvnevdseappakfkyikesivaegvs.kvseeaesgCeCedecseeskCkClaeageea. 71 dis+g+e+vpi+++ne+ds+++ ++fky k+ +++ ++s+ ++ C+C++ c + +kC+Cl+ + ++a gi|143811459|sp|Q96T68.2|SETB2_HUMAN 245 DISNGVESVPISFCNEIDSRKL-PQFKYRKTVWPRAYNLtNFSSMFTDSCDCSEGCIDITKCACLQLTARNAk 316 799*******************.8***********988789***********999*************66556 PP ...........SB-TTSSBSCCH-SEEE---TTSSS-T.T-TT- CS Pre-SET 72 ...........aytkekrlkleeeepiyECnskCkCds.sCknR 103 y+ krl+ + + iyEC+ CkC++ C+nR gi|143811459|sp|Q96T68.2|SETB2_HUMAN 317 tsplssdkittGYK-YKRLQRQIPTGIYECSLLCKCNRqLCQNR 359 67788888876676.78888899**************769***9 PP == domain 3 score: -2.5 bits; conditional E-value: 1.2 S-TTCCC----.--T............T CS Pre-SET 39 skvseeaesgC.eCe............d 53 ++ +++ e+ C +Ce + gi|143811459|sp|Q96T68.2|SETB2_HUMAN 426 FSKKRKLEVACsDCEvevlplglethpR 453 4455555666766764555555544331 PP == domain 4 score: -3.4 bits; conditional E-value: 2.4 T CS Pre-SET 41 v 41 gi|143811459|sp|Q96T68.2|SETB2_HUMAN 596 P 596 1 PP == domain 5 score: -0.2 bits; conditional E-value: 0.23 TCCC------.TTGCT CS Pre-SET 42 seeaesgCeC.edecs 56 e+e+ C+C ++c+ gi|143811459|sp|Q96T68.2|SETB2_HUMAN 700 VPEKEIFCQCgVNKCR 715 4566778888766673 PP >> MBD Methyl-CpG binding domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.1 0.0 1.2 5.7e+03 58 70 .. 97 114 .. 25 120 .. 0.53 2 ! 29.0 0.0 1.1e-10 5.5e-07 6 73 .. 164 228 .. 160 232 .. 0.86 Alignments for each domain: == domain 1 score: -3.1 bits; conditional E-value: 1.2 MBD 58 q.....stsaklknFdfe 70 + + ++++ f gi|143811459|sp|Q96T68.2|SETB2_HUMAN 97 AfpstsCENSFPEDCTFL 114 033333445555555554 PP == domain 2 score: 29.0 bits; conditional E-value: 1.1e-10 MBD 6 edcsvLpkGWrreevqrksGssagkvdvfYysPtGkkfrskkevaayLenakqstsaklknFdfekrl 73 + + + + ++r+ ++ +s+ ++v Y +P+G+ +r +ev +yL ++ + + +nF+f+++ gi|143811459|sp|Q96T68.2|SETB2_HUMAN 164 PLQLPIKCHFQRRHA-KT-NSHSSALHVSYKTPCGRSLRNVEEVFRYLLETE-CNFLFTDNFSFNTYV 228 667788899999999.44.456678***********************9998.9***********976 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (719 residues) Target model(s): 14831 (2610332 nodes) Passed MSV filter: 702 (0.0473333); expected 296.6 (0.02) Passed bias filter: 221 (0.0149012); expected 296.6 (0.02) Passed Vit filter: 21 (0.00141595); expected 14.8 (0.001) Passed Fwd filter: 3 (0.000202279); expected 0.1 (1e-05) Initial search space (Z): 14831 [actual number of targets] Domain search space (domZ): 3 [number of targets reported over threshold] # CPU time: 0.39u 0.22s 00:00:00.61 Elapsed: 00:00:00.20 # Mc/sec: 9384.14 // Query: gi|224177469|ref|NP_036564.3| [L=1290] Description: histone-lysine N-methyltransferase SETDB1 isoform 2 [Homo sapiens] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-60 204.5 0.0 4.3e-60 202.7 0.0 2.1 1 SET SET domain 1.6e-19 70.0 9.7 3.7e-19 68.9 6.7 1.6 1 Pre-SET Pre-SET motif 5.4e-12 45.0 0.0 1.2e-11 43.9 0.0 1.6 1 MBD Methyl-CpG binding domain 0.0027 17.5 0.0 0.0065 16.2 0.0 1.6 1 DUF4537 Domain of unknown function (DUF4537) Domain annotation for each model (and alignments): >> SET SET domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 202.7 0.0 1.2e-63 4.3e-60 1 162 [] 814 1265 .. 814 1265 .. 1.00 Alignments for each domain: == domain 1 score: 202.7 bits; conditional E-value: 1.2e-63 SEEEEESS-B-TTEEEEEECCEEEECCCCHH............................................... CS xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx............................................... RF SET 1 GrGvrAtedIpkgefvceyvgelltddeaek............................................... 31 G+G+r+++dI+kg+fvc+y+g++ltdd+a+k gi|224177469|ref|NP_036564.3| 814 GWGIRCLDDIAKGSFVCIYAGKILTDDFADKeglemgdeyfanldhiesvenfkegyesdapcssdssgvdlkdqedg 891 9***************************************************************************** PP .............................................................................. CS .............................................................................. RF SET 32 .............................................................................. 31 gi|224177469|ref|NP_036564.3| 892 nsgtedpeesnddssddnfckdedfstssvwrsyatrrqtrgqkenglsettskdshppdlgpphipvppsipvggcn 969 ****************************************************************************** PP .............................................................................. CS .............................................................................. RF SET 32 .............................................................................. 31 gi|224177469|ref|NP_036564.3| 970 ppsseetpknkvaswlscnsvseggfadsdshssfktneggegraggsrmeaekastsglgikdegdikqakkedtdd 1047 ****************************************************************************** PP .......................HHHHHHHHHHC.TTCCTCE.................................... CS .....................xxxxxxxxxxxxxxxxxxxxx.................................... RF SET 32 .....................kpelerldlskaleaasrala.................................... 52 kpe++r+++sk+++++sr+l+ gi|224177469|ref|NP_036564.3| 1048 rnkmsvvtessrnygynpspvKPEGLRRPPSKTSMHQSRRLMasaqsnpddvltlssstesegesgtsrkptagqtsa 1125 ****************************************************************************** PP ...........................HHHHHHHHHHTHHHHHHH.TTTS.GGG..HHHHHHHHHHHHHH.EEETTSS CS ...........................xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF SET 53 ...........................akskrqkagksvrspaalsarsgalksalaasvdasesaaepkatedeyee 103 +++krq+a+ks+r++a++s++++a+ks+++asvd++esa+++k+t+++y++ gi|224177469|ref|NP_036564.3| 1126 tavdsddiqtissgsegddfedkknmtGPMKRQVAVKSTRGFALKSTHGIAIKSTNMASVDKGESAPVRKNTRQFYDG 1203 ****************************************************************************** PP CEEEEECEECCECCCGGGHEESSS.SEEEEEECS....TTSSEEEEEESS-B-TTEEEEEEES CS xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx....xxxxxxxxxxxxxxxxxxxxxxxxx RF SET 104 eeseyvidakllgnlarflNHSCdpNltvqavfv....lrlprvaffAtrdIkkGeEltidYg 162 ees+y+idakl+gnl+r+lNHSC+pNl+vq+vfv lr+p+vaffA +I++G+Elt+dY+ gi|224177469|ref|NP_036564.3| 1204 EESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVdthdLRFPWVAFFA-SKIRAGTELTWDYN 1265 ************************************************.88***********7 PP >> Pre-SET Pre-SET motif # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 68.9 6.7 9.9e-23 3.7e-19 1 103 [] 681 795 .. 681 795 .. 0.90 Alignments for each domain: == domain 1 score: 68.9 bits; conditional E-value: 9.9e-23 HCCCTSSSS-EEEESSSST---STTSEE-SS-EE-TTSS.-TTCCC------TTGCTCTTTSGGGTTS-S.......... CS Pre-SET 1 diskgkekvpipvvnevdseappakfkyikesivaegvs.kvseeaesgCeCedecseeskCkClaeageea........ 71 di+ gke vp ++vne+d + p +++ y ke+i+++gv+ ++ e+ +gC+C+d c+++skC+C++ + +++ gi|224177469|ref|NP_036564.3| 681 DITYGKEDVPLSCVNEIDTTPP-PQVAYSKERIPGKGVFiNTGPEFLVGCDCKDGCRDKSKCACHQLTIQATactpggqi 759 67889*************9999.8********************************************776656677777 PP ....SB-TTSSBSCCH-SEEE---TTSSS-T.T-TT- CS Pre-SET 72 ....aytkekrlkleeeepiyECnskCkCds.sCknR 103 y+ krl+ + + +yECn++CkCd+ C+nR gi|224177469|ref|NP_036564.3| 760 npnsGYQ-YKRLEECLPTGVYECNKRCKCDPnMCTNR 795 7776666.66777899**************779***9 PP >> MBD Methyl-CpG binding domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.9 0.0 3.2e-15 1.2e-11 2 73 .. 595 664 .. 594 668 .. 0.92 Alignments for each domain: == domain 1 score: 43.9 bits; conditional E-value: 3.2e-15 MBD 2 erkredcsvLpkGWrreevqrksGssagkvdvfYysPtGkkfrskkevaayLenakqstsaklknFdfekrl 73 + k++ +L +++rr++ r+ ++++ ++v+Y +P+G ++r+++e+++yL +++ ++ + l++F+++++ gi|224177469|ref|NP_036564.3| 595 RGKNPLLVPLLYDFRRMTARRRVNRKM-GFHVIYKTPCGLCLRTMQEIERYLFETG-CDFLFLEMFCLDPYV 664 56888999****************995.9**************************9.9*********99876 PP >> DUF4537 Domain of unknown function (DUF4537) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 16.2 0.0 1.8e-06 0.0065 10 112 .. 209 313 .. 204 324 .. 0.80 Alignments for each domain: == domain 1 score: 16.2 bits; conditional E-value: 1.8e-06 DUF4537 10 eDGfYyrGtvkkrl...nggqylvefeaeetqevqerdiialedakehslkvGDkVLAlhepeeqeY.vPGtVlagperr 85 ++++++Gt+ + g++y v+f+++ + ++ ++i ++ +l vG +V+A+ + +q + + G+V + + gi|224177469|ref|NP_036564.3| 209 RTKTWHKGTLIAIQtvgPGKKYKVKFDNKGKSLLSGNHIAYDYHPPADKLYVGSRVVAKYKDGNQVWlYAGIVAE--TPN 286 56789999998877779999******77777777777776666777*************7777777615677775..456 PP DUF4537 86 saeeeeltVrfwngkkakvpreeviki 112 ++++ + + f +g ++ v ++e++ i gi|224177469|ref|NP_036564.3| 287 VKNKLRFLIFFDDGYASYVTQSELYPI 313 888899999999999999999999987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1290 residues) Target model(s): 14831 (2610332 nodes) Passed MSV filter: 892 (0.0601443); expected 296.6 (0.02) Passed bias filter: 392 (0.0264311); expected 296.6 (0.02) Passed Vit filter: 49 (0.00330389); expected 14.8 (0.001) Passed Fwd filter: 5 (0.000337132); expected 0.1 (1e-05) Initial search space (Z): 14831 [actual number of targets] Domain search space (domZ): 4 [number of targets reported over threshold] # CPU time: 0.60u 0.28s 00:00:00.88 Elapsed: 00:00:00.23 # Mc/sec: 14640.56 // Query: gi|224177467|ref|NP_001138887.1| [L=1291] Description: histone-lysine N-methyltransferase SETDB1 isoform 1 [Homo sapiens] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-63 214.1 0.0 4.7e-63 212.3 0.0 2.1 1 SET SET domain 1.6e-19 70.0 9.7 3.7e-19 68.9 6.7 1.7 1 Pre-SET Pre-SET motif 5.4e-12 45.0 0.0 1.2e-11 43.9 0.0 1.6 1 MBD Methyl-CpG binding domain 0.0027 17.5 0.0 0.0065 16.2 0.0 1.6 1 DUF4537 Domain of unknown function (DUF4537) Domain annotation for each model (and alignments): >> SET SET domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 212.3 0.0 1.3e-66 4.7e-63 1 162 [] 814 1266 .. 814 1266 .. 1.00 Alignments for each domain: == domain 1 score: 212.3 bits; conditional E-value: 1.3e-66 SEEEEESS-B-TTEEEEEECCEEEECCCCHH............................................ CS xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx............................................ RF SET 1 GrGvrAtedIpkgefvceyvgelltddeaek............................................ 31 G+G+r+++dI+kg+fvc+y+g++ltdd+a+k gi|224177467|ref|NP_001138887.1| 814 GWGIRCLDDIAKGSFVCIYAGKILTDDFADKeglemgdeyfanldhiesvenfkegyesdapcssdssgvdlkdq 888 9************************************************************************** PP ........................................................................... CS ........................................................................... RF SET 32 ........................................................................... 31 gi|224177467|ref|NP_001138887.1| 889 edgnsgtedpeesnddssddnfckdedfstssvwrsyatrrqtrgqkenglsettskdshppdlgpphipvppsi 963 *************************************************************************** PP ........................................................................... CS ........................................................................... RF SET 32 ........................................................................... 31 gi|224177467|ref|NP_001138887.1| 964 pvggcnppsseetpknkvaswlscnsvseggfadsdshssfktneggegraggsrmeaekastsglgikdegdik 1038 *************************************************************************** PP ................................HHHHHHHHHHC.TTCCTCE........................ CS ..............................xxxxxxxxxxxxxxxxxxxxx........................ RF SET 32 ..............................kpelerldlskaleaasrala........................ 52 kpe++r+++sk+++++sr+l+ gi|224177467|ref|NP_001138887.1| 1039 qakkedtddrnkmsvvtessrnygynpspvKPEGLRRPPSKTSMHQSRRLMasaqsnpddvltlssstesegesg 1113 *************************************************************************** PP .......................................HHHHHHHHHHTHHHHHHH.TTTS.GGG..HHHHHHH CS .......................................xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF SET 53 .......................................akskrqkagksvrspaalsarsgalksalaasvdas 88 +++krq+a+ks+r++a++s++++a+ks+++asvd++ gi|224177467|ref|NP_001138887.1| 1114 tsrkptagqtsatavdsddiqtissgsegddfedkknmtGPMKRQVAVKSTRGFALKSTHGIAIKSTNMASVDKG 1188 *************************************************************************** PP HHHHHHH.EEETTSSCEEEEECEECCECCCGGGHEESSS.SEEEEEECS....TTSSEEEEEESS-B-TTEEEEE CS xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx....xxxxxxxxxxxxxxxxxxxxxx RF SET 89 esaaepkatedeyeeeeseyvidakllgnlarflNHSCdpNltvqavfv....lrlprvaffAtrdIkkGeElti 159 esa+++k+t+++y++ees+y+idakl+gnl+r+lNHSC+pNl+vq+vfv lr+p+vaffA+++I++G+Elt+ gi|224177467|ref|NP_001138887.1| 1189 ESAPVRKNTRQFYDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVdthdLRFPWVAFFASKRIRAGTELTW 1263 *************************************************************************** PP EES CS xxx RF SET 160 dYg 162 dY+ gi|224177467|ref|NP_001138887.1| 1264 DYN 1266 **7 PP >> Pre-SET Pre-SET motif # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 68.9 6.7 9.9e-23 3.7e-19 1 103 [] 681 795 .. 681 795 .. 0.90 Alignments for each domain: == domain 1 score: 68.9 bits; conditional E-value: 9.9e-23 HCCCTSSSS-EEEESSSST---STTSEE-SS-EE-TTSS.-TTCCC------TTGCTCTTTSGGGTTS-S....... CS Pre-SET 1 diskgkekvpipvvnevdseappakfkyikesivaegvs.kvseeaesgCeCedecseeskCkClaeageea..... 71 di+ gke vp ++vne+d + p +++ y ke+i+++gv+ ++ e+ +gC+C+d c+++skC+C++ + +++ gi|224177467|ref|NP_001138887.1| 681 DITYGKEDVPLSCVNEIDTTPP-PQVAYSKERIPGKGVFiNTGPEFLVGCDCKDGCRDKSKCACHQLTIQATactpg 756 67889*************9999.8********************************************776656677 PP .......SB-TTSSBSCCH-SEEE---TTSSS-T.T-TT- CS Pre-SET 72 .......aytkekrlkleeeepiyECnskCkCds.sCknR 103 y+ krl+ + + +yECn++CkCd+ C+nR gi|224177467|ref|NP_001138887.1| 757 gqinpnsGYQ-YKRLEECLPTGVYECNKRCKCDPnMCTNR 795 7777776666.66777899**************779***9 PP >> MBD Methyl-CpG binding domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.9 0.0 3.2e-15 1.2e-11 2 73 .. 595 664 .. 594 668 .. 0.92 Alignments for each domain: == domain 1 score: 43.9 bits; conditional E-value: 3.2e-15 MBD 2 erkredcsvLpkGWrreevqrksGssagkvdvfYysPtGkkfrskkevaayLenakqstsaklknFdfekrl 73 + k++ +L +++rr++ r+ ++++ ++v+Y +P+G ++r+++e+++yL +++ ++ + l++F+++++ gi|224177467|ref|NP_001138887.1| 595 RGKNPLLVPLLYDFRRMTARRRVNRKM-GFHVIYKTPCGLCLRTMQEIERYLFETG-CDFLFLEMFCLDPYV 664 56888999****************995.9**************************9.9*********99876 PP >> DUF4537 Domain of unknown function (DUF4537) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 16.2 0.0 1.8e-06 0.0065 10 112 .. 209 313 .. 204 324 .. 0.80 Alignments for each domain: == domain 1 score: 16.2 bits; conditional E-value: 1.8e-06 DUF4537 10 eDGfYyrGtvkkrl...nggqylvefeaeetqevqerdiialedakehslkvGDkVLAlhepeeqeY.vPGtVlagp 82 ++++++Gt+ + g++y v+f+++ + ++ ++i ++ +l vG +V+A+ + +q + + G+V + gi|224177467|ref|NP_001138887.1| 209 RTKTWHKGTLIAIQtvgPGKKYKVKFDNKGKSLLSGNHIAYDYHPPADKLYVGSRVVAKYKDGNQVWlYAGIVAE-- 283 56789999998877779999******77777777777776666777*************7777777615677775.. PP DUF4537 83 errsaeeeeltVrfwngkkakvpreeviki 112 +++++ + + f +g ++ v ++e++ i gi|224177467|ref|NP_001138887.1| 284 TPNVKNKLRFLIFFDDGYASYVTQSELYPI 313 456888899999999999999999999987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1291 residues) Target model(s): 14831 (2610332 nodes) Passed MSV filter: 893 (0.0602117); expected 296.6 (0.02) Passed bias filter: 394 (0.026566); expected 296.6 (0.02) Passed Vit filter: 49 (0.00330389); expected 14.8 (0.001) Passed Fwd filter: 5 (0.000337132); expected 0.1 (1e-05) Initial search space (Z): 14831 [actual number of targets] Domain search space (domZ): 4 [number of targets reported over threshold] # CPU time: 0.61u 0.27s 00:00:00.88 Elapsed: 00:00:00.23 # Mc/sec: 14651.91 //