# hmmscan :: search sequence(s) against a profile database # HMMER 3.0 (March 2010); http://hmmer.org/ # Copyright (C) 2010 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: ORC3.fasta # target HMM database: /N/dc2/projects/marinovg/genomes/PFam/PFam27.0/Pfam-A.hmm # output directed to file: ORC3.PFam-27-A # per-seq hits tabular output: Spt16-hmmscan.tblout # number of worker threads: 16 # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: gi|4337056|gb|AAD18057.1| [L=711] Description: origin recognition complex subunit 3 [Homo sapiens] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-136 453.6 7.7 5.4e-136 452.8 5.4 1.4 1 ORC3_N Origin recognition complex (ORC) subunit 3 N-termi Domain annotation for each model (and alignments): >> ORC3_N Origin recognition complex (ORC) subunit 3 N-terminus # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 452.8 5.4 3.7e-140 5.4e-136 3 330 .] 17 344 .. 14 344 .. 0.99 Alignments for each domain: == domain 1 score: 452.8 bits; conditional E-value: 3.7e-140 ORC3_N 3 aakrkksksledafeeeseddeelaselrfeayeklWekikseieelqdelnakildqllefvressasrqeeareteskvkar 86 ++krk s +ed+f++++++ e+ s+lrfe+y+ +W+++kse e+lq+eln++++d+l+ef+++s++ +q+++r+ ++k r gi|4337056|gb|AAD18057.1| 17 SKKRKISLPIEDYFNKGKNEPED--SKLRFETYQLIWQQMKSENERLQEELNKNLFDNLIEFLQKSHSGFQKNSRDLGGQIKLR 98 57899******************..*********************************************************** PP ORC3_N 87 eiptaalltgvnvtDheltFesLtesLkksvtahVvlLqskdlsalkaalekllrqlveeksdveeeeeeee.ialrkvqltis 169 eiptaal++gvnvtDh+ltF sLte L+++vt++Vv+Lq+kd++++k++l+kl++ql+++++d++++eee+ +++rk++++++ gi|4337056|gb|AAD18057.1| 99 EIPTAALVLGVNVTDHDLTFGSLTEALQNNVTPYVVSLQAKDCPDMKHFLQKLISQLMDCCVDIKSKEEESVhVTQRKTHYSMD 182 *****************************************************************9999988899********* PP ORC3_N 170 alaswYkasgeksdska.kkknaesseaesppvvvileDlEsfsgkVLqdfililseyvselPlvlvlGiATsvsaiqklLpas 252 +l+swY+++++k+d k+ +kk+++ss+++sppvvvil+D+Esf +kVLqdfi+i+s++++e+Pl+l++GiATs+ +i++lLp++ gi|4337056|gb|AAD18057.1| 183 SLSSWYMTVTQKTDPKMlSKKRTTSSQWQSPPVVVILKDMESFATKVLQDFIIISSQHLHEFPLILIFGIATSPIIIHRLLPHA 266 ************************************************************************************ PP ORC3_N 253 vssllklelfqslspsqrLeavldkvlLtpefpfklsskvlkvLtsiFlyhDfsvqnfikglklalleHFlteplsvl 330 vssll++elfqsls++++L++vldk+lLt++fpfk+++kvl+vLt+iFlyhDfsvqnfikgl+l+lleHF+++plsvl gi|4337056|gb|AAD18057.1| 267 VSSLLCIELFQSLSCKEHLTTVLDKLLLTTQFPFKINEKVLQVLTNIFLYHDFSVQNFIKGLQLSLLEHFYSQPLSVL 344 ****************************************************************************98 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (711 residues) Target model(s): 14831 (2610332 nodes) Passed MSV filter: 859 (0.0579192); expected 296.6 (0.02) Passed bias filter: 306 (0.0206325); expected 296.6 (0.02) Passed Vit filter: 27 (0.00182051); expected 14.8 (0.001) Passed Fwd filter: 2 (0.000134853); expected 0.1 (1e-05) Initial search space (Z): 14831 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.48u 0.49s 00:00:00.97 Elapsed: 00:00:03.42 # Mc/sec: 542.67 //