******************************************************************************** MEME - Motif discovery tool ******************************************************************************** MEME version 5.0.1 (Release date: Wed Aug 22 15:26:53 2018 -0700) For further information on how to interpret please access http://meme-suite.org. To get a copy of the MEME software please access http://meme-suite.org. ******************************************************************************** ******************************************************************************** REFERENCE ******************************************************************************** If you use this program in your research, please cite: Timothy L. Bailey and Charles Elkan, "Fitting a mixture model by expectation maximization to discover motifs in biopolymers", Proceedings of the Second International Conference on Intelligent Systems for Molecular Biology, pp. 28-36, AAAI Press, Menlo Park, California, 1994. ******************************************************************************** ******************************************************************************** TRAINING SET ******************************************************************************** PRIMARY SEQUENCES= common/lipocalin.s CONTROL SEQUENCES= --none-- ALPHABET= ACDEFGHIKLMNPQRSTVWY Sequence name Weight Length Sequence name Weight Length ------------- ------ ------ ------------- ------ ------ ICYA_MANSE 1.0000 189 LACB_BOVIN 1.0000 178 BBP_PIEBR 1.0000 173 RETB_BOVIN 1.0000 183 MUP2_MOUSE 1.0000 180 ******************************************************************************** ******************************************************************************** COMMAND LINE SUMMARY ******************************************************************************** This information can also be useful in the event you wish to report a problem with the MEME software. command: meme common/lipocalin.s -oc results/meme17 -mod zoops -protein -nmotifs 2 -objfun classic -minw 8 -nostatus model: mod= zoops nmotifs= 2 evt= inf objective function: em= E-value of product of p-values starts= E-value of product of p-values width: minw= 8 maxw= 50 nsites: minsites= 2 maxsites= 5 wnsites= 0.8 theta: spmap= pam spfuzz= 120 em: prior= megap b= 4515 maxiter= 50 distance= 1e-05 trim: wg= 11 ws= 1 endgaps= yes data: n= 903 N= 5 sample: seed= 0 hsfrac= 0 searchsize= 903 norand= no csites= 1000 Dirichlet mixture priors file: prior30.plib Letter frequencies in dataset: A 0.072 C 0.0288 D 0.0687 E 0.0775 F 0.0432 G 0.0576 H 0.0255 I 0.0476 K 0.0864 L 0.0875 M 0.0177 N 0.0532 P 0.0321 Q 0.0288 R 0.031 S 0.0587 T 0.0476 V 0.0698 W 0.0166 Y 0.0498 Background letter frequencies (from file dataset with add-one prior applied): A 0.0715 C 0.0293 D 0.0683 E 0.0769 F 0.0433 G 0.0574 H 0.026 I 0.0477 K 0.0856 L 0.0867 M 0.0184 N 0.0531 P 0.0325 Q 0.0293 R 0.0314 S 0.0585 T 0.0477 V 0.0693 W 0.0173 Y 0.0498 Background model order: 0 ******************************************************************************** ******************************************************************************** MOTIF GACPEVKPVENFDISKFAGTWYEIAK MEME-1 width = 26 sites = 5 llr = 244 E-value = 5.0e-006 ******************************************************************************** -------------------------------------------------------------------------------- Motif GACPEVKPVENFDISKFAGTWYEIAK MEME-1 Description -------------------------------------------------------------------------------- Simplified A :6::2:::::::::22:6:2::2:8: pos.-specific C 2:4::::::::::::::::::::::: probability D ::::2::::22:8::::::::::::: matrix E ::222::::2::::2::::2::4::: F :::::2:::::8::::4::::::::: G 4:::::::2:2:::::::a::::::: H 2::::::::::::::::2:::4:::: I :::2:::::::::2::2::::::42: K ::::::4:22:::2:4:::2:::::6 L ::2::::::::2:2:::::::::2:2 M ::::::::2::::::::::::::2:2 N :::::::::26:2::2:2:::::::: P :::4:::4:::::::::::::::::: Q 2:::::2:::::::2::::::::::: R :2::::2::2:::::2:::::::::: S :::2222:::::::4:::::::2::: T :::::2:4:::::::::::4::2::: V ::2:24:24::::2::2::::::2:: W :::::::::::::2::::::a2:::: Y :2::::::::::::::2::::4:::: bits 5.9 * 5.3 * 4.7 * 4.1 * * Relative 3.5 ** * ** Entropy 2.9 ** * *** ** ** * (70.4 bits) 2.3 **** **** *** ***** ** *** 1.8 ************************** 1.2 ************************** 0.6 ************************** 0.0 -------------------------- Multilevel GACPAVKPVDNFDISKFAGTWHEIAK consensus CREEDFQTGEDLNKAAIH A YALIL sequence HYLIESRVKKG LENVN E WSM M Q VSSTS MN VQRY K TV V R W -------------------------------------------------------------------------------- -------------------------------------------------------------------------------- Motif GACPEVKPVENFDISKFAGTWYEIAK MEME-1 sites sorted by position p-value -------------------------------------------------------------------------------- Sequence name Start P-value Site ------------- ----- --------- -------------------------- BBP_PIEBR 6 1.76e-24 NVYHD GACPEVKPVDNFDWSNYHGKWWEVAK YPNSVEKYGK ICYA_MANSE 7 2.29e-24 GDIFYP GYCPDVKPVNDFDLSAFAGAWHEIAK LPLENENQGK RETB_BOVIN 4 1.97e-19 ERD CRVSSFRVKENFDKARFAGTWYAMAK KDPEGLFLQD LACB_BOVIN 15 2.92e-18 LLALALTCGA QALIVTQTMKGLDIQKVAGTWYSLAM AASDISLLDA MUP2_MOUSE 17 6.60e-17 LCLGLTLVCV HAEEASSTGRNFNVEKINGEWHTIIL ASDKREKIED -------------------------------------------------------------------------------- -------------------------------------------------------------------------------- Motif GACPEVKPVENFDISKFAGTWYEIAK MEME-1 block diagrams -------------------------------------------------------------------------------- SEQUENCE NAME POSITION P-VALUE MOTIF DIAGRAM ------------- ---------------- ------------- BBP_PIEBR 1.8e-24 5_[1]_142 ICYA_MANSE 2.3e-24 6_[1]_157 RETB_BOVIN 2e-19 3_[1]_154 LACB_BOVIN 2.9e-18 14_[1]_138 MUP2_MOUSE 6.6e-17 16_[1]_138 -------------------------------------------------------------------------------- -------------------------------------------------------------------------------- Motif GACPEVKPVENFDISKFAGTWYEIAK MEME-1 in BLOCKS format -------------------------------------------------------------------------------- BL MOTIF GACPEVKPVENFDISKFAGTWYEIAK width=26 seqs=5 BBP_PIEBR ( 6) GACPEVKPVDNFDWSNYHGKWWEVAK 1 ICYA_MANSE ( 7) GYCPDVKPVNDFDLSAFAGAWHEIAK 1 RETB_BOVIN ( 4) CRVSSFRVKENFDKARFAGTWYAMAK 1 LACB_BOVIN ( 15) QALIVTQTMKGLDIQKVAGTWYSLAM 1 MUP2_MOUSE ( 17) HAEEASSTGRNFNVEKINGEWHTIIL 1 // -------------------------------------------------------------------------------- -------------------------------------------------------------------------------- Motif GACPEVKPVENFDISKFAGTWYEIAK MEME-1 position-specific scoring matrix -------------------------------------------------------------------------------- log-odds matrix: alength= 20 w= 26 n= 778 bayes= 8.22029 E= 5.0e-006 -99 144 -149 -133 -258 269 220 -210 -126 -235 -128 -87 -179 195 -34 -79 -105 -210 -298 -234 289 -172 -248 -188 -180 -145 -158 -164 -148 -197 -97 -189 -221 -78 150 -45 -105 -120 -261 74 -84 312 -314 44 -111 -230 -180 36 -244 92 33 -225 -204 -122 -125 -133 -66 134 -214 -197 -92 -302 -187 36 -266 -208 -155 70 -160 -213 -130 -170 388 -48 -75 72 -103 -192 -332 -302 115 -282 98 109 -244 -150 -77 -177 -69 -197 -86 -77 -126 44 3 111 -51 64 -285 -236 -68 -167 -316 -260 114 -226 -183 30 -258 -72 12 -219 -200 -135 -133 94 163 231 -223 -188 -144 -348 -210 -121 -328 -216 -91 -243 200 -239 -133 -129 -194 225 247 114 -111 -243 -308 -284 -92 -241 -296 -256 -247 -224 -228 -114 -258 -190 -105 -229 361 -140 -151 -72 242 70 -329 -324 -63 -187 -232 -163 -140 75 -134 22 37 -77 241 -166 -172 -50 -40 -100 -53 221 -226 -208 -71 -310 103 103 -254 -142 -60 -205 81 -207 -94 124 -126 52 201 -34 -50 -195 -285 -234 -242 -375 91 -196 -382 91 -98 -352 -244 -408 -311 349 -242 -122 -182 -80 -157 -389 -396 -351 -318 -290 -467 -456 425 -424 -363 -172 -484 -47 -115 -430 -331 -374 -362 -296 -352 -245 -202 -103 -301 -418 363 -117 -408 -310 -244 -367 -403 -415 -323 -21 -370 -260 -284 -260 -313 -381 -414 -410 -107 -180 -350 -287 -106 -249 -200 252 -6 95 46 -249 -222 -152 -148 -153 -77 137 216 -191 96 -298 -79 114 -258 -152 -75 -202 -65 -209 -96 -73 -125 216 7 200 -40 -190 -293 -244 64 -339 -187 -115 -314 -207 -99 -238 223 -242 -134 100 -185 18 221 -102 -106 -241 -310 -282 -181 -226 -378 -340 342 -310 -122 98 -351 -88 -39 -304 -258 -227 -212 -200 -176 42 -146 170 273 -215 -127 -140 -272 -123 195 -223 -154 -247 -141 118 -194 -56 -71 -37 -96 -174 -321 -276 -199 -393 -301 -366 -446 397 -329 -419 -374 -473 -336 -252 -326 -311 -240 -221 -320 -402 -399 -453 89 -295 -91 104 -246 -153 -67 -184 77 -196 -82 -70 -123 52 29 -26 223 -176 -280 -234 -388 -388 -438 -441 -134 -384 -353 -366 -445 -245 -239 -397 -380 -302 -275 -375 -361 -359 569 -207 -290 -318 -383 -376 73 -361 354 -252 -386 -230 -173 -259 -307 -176 -201 -252 -277 -283 286 292 106 -271 -98 173 -260 -150 -94 -198 -87 -214 -101 -85 -134 26 -13 137 156 -184 -300 -255 -245 -306 -430 -410 -197 -384 -361 357 -396 52 172 -359 -346 -288 -287 -287 -197 121 -336 -320 328 -140 -375 -329 -260 -140 -310 72 -352 -199 -114 -318 -308 -242 -222 -45 -138 -72 -331 -364 -192 -313 -316 -228 -235 -288 -185 -128 276 36 217 -224 -256 -77 45 -195 -163 -176 -307 -304 -------------------------------------------------------------------------------- -------------------------------------------------------------------------------- Motif GACPEVKPVENFDISKFAGTWYEIAK MEME-1 position-specific probability matrix -------------------------------------------------------------------------------- letter-probability matrix: alength= 20 w= 26 nsites= 5 E= 5.0e-006 0.000000 0.200000 0.000000 0.000000 0.000000 0.400000 0.200000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.200000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.600000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.200000 0.000000 0.000000 0.000000 0.000000 0.200000 0.000000 0.400000 0.000000 0.200000 0.000000 0.000000 0.000000 0.000000 0.000000 0.200000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.200000 0.000000 0.000000 0.000000 0.000000 0.000000 0.200000 0.000000 0.000000 0.000000 0.200000 0.000000 0.000000 0.000000 0.000000 0.400000 0.000000 0.000000 0.200000 0.000000 0.000000 0.000000 0.000000 0.200000 0.000000 0.200000 0.200000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.200000 0.000000 0.200000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.200000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.200000 0.200000 0.400000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.400000 0.000000 0.000000 0.000000 0.000000 0.200000 0.200000 0.200000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.400000 0.000000 0.000000 0.000000 0.400000 0.200000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.200000 0.000000 0.000000 0.200000 0.000000 0.200000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.400000 0.000000 0.000000 0.000000 0.000000 0.200000 0.200000 0.000000 0.000000 0.000000 0.000000 0.200000 0.000000 0.000000 0.200000 0.000000 0.000000 0.200000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.200000 0.000000 0.000000 0.200000 0.000000 0.000000 0.000000 0.000000 0.000000 0.600000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.800000 0.000000 0.000000 0.000000 0.000000 0.200000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.800000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.200000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.200000 0.200000 0.200000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.200000 0.200000 0.000000 0.200000 0.000000 0.000000 0.200000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.200000 0.000000 0.400000 0.000000 0.000000 0.000000 0.000000 0.200000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.400000 0.000000 0.000000 0.200000 0.000000 0.000000 0.200000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.400000 0.000000 0.000000 0.200000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.200000 0.000000 0.200000 0.600000 0.000000 0.000000 0.000000 0.000000 0.000000 0.200000 0.000000 0.000000 0.000000 0.000000 0.200000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.200000 0.000000 0.000000 0.200000 0.000000 0.000000 0.000000 0.000000 0.200000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.400000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.400000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.200000 0.400000 0.200000 0.000000 0.000000 0.400000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.200000 0.200000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.400000 0.000000 0.200000 0.200000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.200000 0.000000 0.000000 0.800000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.200000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.600000 0.200000 0.200000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 -------------------------------------------------------------------------------- -------------------------------------------------------------------------------- Motif GACPEVKPVENFDISKFAGTWYEIAK MEME-1 regular expression -------------------------------------------------------------------------------- [GCHQ][ARY][CELV][PEIS][ADESV][VFST][KQRS][PTV][VGKM][DEKNR][NDG][FL][DN][IKLVW][SAEQ][KANR][FIVY][AHN]G[TAEK]W[HYW][EAST][ILMV][AI][KLM] -------------------------------------------------------------------------------- Time 0.08 secs. ******************************************************************************** ******************************************************************************** MOTIF VFWVLATDNKNYIIGYNCDYDPDKKGHQDFVWILSKSKVLEG MEME-2 width = 42 sites = 2 llr = 218 E-value = 8.6e-004 ******************************************************************************** -------------------------------------------------------------------------------- Motif VFWVLATDNKNYIIGYNCDYDPDKKGHQDFVWILSKSKVLEG MEME-2 Description -------------------------------------------------------------------------------- Simplified A :::::5::::::5::::::::::::5::::5::::::::::: pos.-specific C :::::::::::::::::a:::::::::::::::::::::::: probability D :::::::a::::::::::5:5:a:::::5::::::::::::: matrix E :::::::::::::::::::::5::::::::::::::::::5: F :5:::::::::::::::::::::::::::5:::::::::::: G ::::::::::::::5::::::::::5:::::::::::::::a H ::::::::::::::::::::5:::::a::5:::::::::::: I ::::::::::::5a::::::::::::::5:::5::::::::: K :::::::::a::::::::5::::aa::::::::::5:a:::: L ::::a::::::::::::::::::::::::::::a:::::a:: M :::::::::::::::::::::::::::::::::::::::::: N ::5:::::5:a:::5:5::::::::::::::::::::::::: P :5:::::::::::::::::::5:::::::::::::::::::: Q :::::::::::::::::::::::::::5:::::::::::::: R :::::::::::::::::::::::::::::::::::5:::::: S :::::5:::::::::::::::::::::5::::::a:a::::: T ::::::a:::::::::::::::::::::::::::::::::5: V a::a::::::::::::::::::::::::::5:5:::::a::: W ::5::::::::::::::::::::::::::::a:::::::::: Y ::::::::5::a:::a5::a:::::::::::::::::::::: bits 5.9 * 5.3 * * * 4.7 * * * * * 4.1 * ** ** ** * * * * * * * * * * * * Relative 3.5 ***** ****** * *** ****** ** * * ******* * Entropy 2.9 ****************************************** (157.6 bits) 2.3 ****************************************** 1.8 ****************************************** 1.2 ****************************************** 0.6 ****************************************** 0.0 ------------------------------------------ Multilevel VFNVLATDNKNYAIGYNCDYDEDKKAHQDFAWILSKSKVLEG consensus PW S Y I N Y K HP G SIHV V R T sequence -------------------------------------------------------------------------------- -------------------------------------------------------------------------------- Motif VFWVLATDNKNYIIGYNCDYDPDKKGHQDFVWILSKSKVLEG MEME-2 sites sorted by position p-value -------------------------------------------------------------------------------- Sequence name Start P-value Site ------------- ----- --------- ------------------------------------------ ICYA_MANSE 102 7.93e-48 FKFGQRVVNL VPWVLATDYKNYAINYNCDYHPDKKAHSIHAWILSKSKVLEG NTKEVVDNVL BBP_PIEBR 98 4.24e-47 LTYGGVTKEN VFNVLSTDNKNYIIGYYCKYDEDKKGHQDFVWVLSRSKVLTG EAKTAVENYL -------------------------------------------------------------------------------- -------------------------------------------------------------------------------- Motif VFWVLATDNKNYIIGYNCDYDPDKKGHQDFVWILSKSKVLEG MEME-2 block diagrams -------------------------------------------------------------------------------- SEQUENCE NAME POSITION P-VALUE MOTIF DIAGRAM ------------- ---------------- ------------- ICYA_MANSE 7.9e-48 101_[2]_46 BBP_PIEBR 4.2e-47 97_[2]_34 -------------------------------------------------------------------------------- -------------------------------------------------------------------------------- Motif VFWVLATDNKNYIIGYNCDYDPDKKGHQDFVWILSKSKVLEG MEME-2 in BLOCKS format -------------------------------------------------------------------------------- BL MOTIF VFWVLATDNKNYIIGYNCDYDPDKKGHQDFVWILSKSKVLEG width=42 seqs=2 ICYA_MANSE ( 102) VPWVLATDYKNYAINYNCDYHPDKKAHSIHAWILSKSKVLEG 1 BBP_PIEBR ( 98) VFNVLSTDNKNYIIGYYCKYDEDKKGHQDFVWVLSRSKVLTG 1 // -------------------------------------------------------------------------------- -------------------------------------------------------------------------------- Motif VFWVLATDNKNYIIGYNCDYDPDKKGHQDFVWILSKSKVLEG MEME-2 position-specific scoring matrix -------------------------------------------------------------------------------- log-odds matrix: alength= 20 w= 42 n= 698 bayes= 8.44294 E= 8.6e-004 -79 -197 -355 -318 -210 -299 -268 107 -341 -110 -67 -322 -234 -238 -197 -229 -101 331 -339 -344 -137 -239 -277 -259 326 -239 -146 -122 -264 -107 -86 -234 308 -139 -142 -141 -155 -151 -95 -24 -243 -321 -175 -279 -121 -223 -96 -239 -261 -226 -172 228 -262 -131 -126 -166 -184 -265 489 -152 -79 -197 -355 -318 -210 -299 -268 107 -341 -110 -67 -322 -234 -238 -197 -229 -101 331 -339 -344 -232 -281 -423 -355 -89 -354 -279 14 -351 312 78 -355 -259 -193 -199 -277 -203 -82 -245 -269 260 -124 -231 -211 -237 -73 -197 -179 -228 -221 -115 -161 -123 -111 -115 215 18 -110 -289 -286 -115 -208 -264 -265 -263 -222 -217 -136 -243 -236 -102 -136 -191 -130 -130 78 380 -138 -309 -322 -283 -407 363 -98 -394 -295 -235 -352 -376 -398 -307 -82 -341 -233 -263 -250 -296 -363 -401 -396 -147 -254 -80 -171 21 -153 82 -155 -172 -189 -105 285 -177 -52 -64 -70 -102 -191 -74 197 -305 -400 -419 -355 -479 -375 -305 -337 336 -408 -297 -310 -331 -224 52 -330 -294 -410 -407 -460 -290 -351 -175 -321 -339 -249 -79 -270 -296 -362 -255 396 -272 -163 -203 -117 -181 -336 -332 -353 -177 -240 -286 -271 130 -250 12 -148 -272 -147 -90 -220 -212 -153 -133 -164 -184 -183 -24 366 186 -147 -282 -245 -131 -169 -213 265 -247 -37 9 -228 -165 -135 -134 -90 -74 105 -242 -226 -227 -291 -398 -381 -193 -360 -348 379 -367 -11 8 -337 -320 -272 -264 -272 -181 100 -334 -306 -132 -312 -93 -193 -330 316 -121 -289 -216 -339 -227 220 -205 -115 -118 -85 -149 -292 -313 -322 -177 -240 -286 -271 130 -250 12 -148 -272 -147 -90 -220 -212 -153 -133 -164 -184 -183 -24 366 -147 -254 -80 -171 21 -153 82 -155 -172 -189 -105 285 -177 -52 -64 -70 -102 -191 -74 197 -352 503 -549 -513 -466 -488 -464 -376 -574 -454 -338 -497 -462 -440 -393 -414 -349 -449 -559 -570 -129 -328 242 -9 -297 -142 -105 -237 165 -262 -158 -42 -149 -4 21 -88 -109 -238 -296 -276 -177 -240 -286 -271 130 -250 12 -148 -272 -147 -90 -220 -212 -153 -133 -164 -184 -183 -24 366 -183 -327 287 -65 -253 -171 284 -276 -201 -289 -190 -4 -197 -16 -79 -118 -154 -273 -282 -182 -101 -319 -72 213 -284 -181 -145 -229 -148 -241 -161 -148 341 12 -70 -102 -119 -215 -319 -301 -283 -407 363 -98 -394 -295 -235 -352 -376 -398 -307 -82 -341 -233 -263 -250 -296 -363 -401 -396 -305 -400 -419 -355 -479 -375 -305 -337 336 -408 -297 -310 -331 -224 52 -330 -294 -410 -407 -460 -305 -400 -419 -355 -479 -375 -305 -337 336 -408 -297 -310 -331 -224 52 -330 -294 -410 -407 -460 199 -186 -237 -248 -298 312 -237 -239 -270 -284 -174 -191 -182 -169 -150 -53 -130 -169 -312 -340 -251 -299 -223 -251 -169 -257 478 -292 -278 -251 -155 -70 -221 34 -46 -163 -183 -289 -217 -71 -58 -241 -120 -57 -236 -135 -5 -183 -92 -192 -82 -53 -91 354 16 179 18 -185 -243 -234 -161 -273 270 -82 -205 -214 -177 215 -233 -119 -74 -88 -202 -113 -137 -161 -140 -8 -273 -263 -185 -239 -243 -252 281 -254 348 -145 -265 -129 -82 -121 -202 -31 -84 -154 -166 -174 -42 136 212 -142 -296 -257 -186 -157 -226 48 -277 -120 -55 -255 -177 -162 -152 -78 -74 246 -277 -283 -372 -376 -426 -428 -122 -371 -335 -347 -429 -233 -225 -383 -367 -289 -261 -360 -346 -344 567 -191 -159 -242 -393 -370 -194 -350 -324 329 -369 -32 -7 -335 -296 -267 -250 -262 -144 224 -335 -319 -232 -281 -423 -355 -89 -354 -279 14 -351 312 78 -355 -259 -193 -199 -277 -203 -82 -245 -269 -69 -199 -243 -264 -279 -169 -219 -249 -253 -287 -177 -124 -169 -158 -135 352 119 -256 -326 -308 -247 -353 -346 -266 -414 -302 -180 -299 268 -325 -228 -236 -261 -82 333 -237 -222 -342 -332 -379 -69 -199 -243 -264 -279 -169 -219 -249 -253 -287 -177 -124 -169 -158 -135 352 119 -256 -326 -308 -305 -400 -419 -355 -479 -375 -305 -337 336 -408 -297 -310 -331 -224 52 -330 -294 -410 -407 -460 -79 -197 -355 -318 -210 -299 -268 107 -341 -110 -67 -322 -234 -238 -197 -229 -101 331 -339 -344 -232 -281 -423 -355 -89 -354 -279 14 -351 312 78 -355 -259 -193 -199 -277 -203 -82 -245 -269 -93 -271 -46 252 -263 -166 -113 -176 -114 -220 -118 -96 -123 29 -40 -20 180 -162 -288 -264 -158 -352 -261 -321 -404 391 -289 -372 -331 -425 -294 -212 -283 -265 -201 -180 -272 -356 -365 -412 -------------------------------------------------------------------------------- -------------------------------------------------------------------------------- Motif VFWVLATDNKNYIIGYNCDYDPDKKGHQDFVWILSKSKVLEG MEME-2 position-specific probability matrix -------------------------------------------------------------------------------- letter-probability matrix: alength= 20 w= 42 nsites= 2 E= 8.6e-004 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.500000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.500000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.500000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.500000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.500000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.500000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.500000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.500000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 1.000000 0.500000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.500000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.500000 0.000000 0.000000 0.000000 0.000000 0.000000 0.500000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.500000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.500000 0.000000 1.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.500000 0.000000 0.000000 0.000000 0.000000 0.000000 0.500000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.500000 0.000000 0.000000 0.000000 0.500000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.500000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.500000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.500000 0.000000 0.000000 0.000000 0.000000 0.500000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.500000 0.000000 0.500000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.500000 0.000000 0.000000 0.000000 0.000000 0.500000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.500000 0.000000 0.500000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.500000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.500000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.500000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.500000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.500000 0.000000 0.000000 0.000000 0.000000 0.000000 0.500000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.500000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.500000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 -------------------------------------------------------------------------------- -------------------------------------------------------------------------------- Motif VFWVLATDNKNYIIGYNCDYDPDKKGHQDFVWILSKSKVLEG MEME-2 regular expression -------------------------------------------------------------------------------- V[FP][NW]VL[AS]TD[NY]KNY[AI]I[GN]Y[NY]C[DK]Y[DH][EP]DKK[AG]H[QS][DI][FH][AV]W[IV]LS[KR]SKVL[ET]G -------------------------------------------------------------------------------- Time 0.16 secs. ******************************************************************************** ******************************************************************************** SUMMARY OF MOTIFS ******************************************************************************** -------------------------------------------------------------------------------- Combined block diagrams: non-overlapping sites with p-value < 0.0001 -------------------------------------------------------------------------------- SEQUENCE NAME COMBINED P-VALUE MOTIF DIAGRAM ------------- ---------------- ------------- ICYA_MANSE 6.79e-65 6_[1(2.29e-24)]_69_[2(7.93e-48)]_46 LACB_BOVIN 1.79e-15 14_[1(2.92e-18)]_138 BBP_PIEBR 2.22e-64 5_[1(1.76e-24)]_66_[2(4.24e-47)]_34 RETB_BOVIN 1.28e-16 3_[1(1.97e-19)]_154 MUP2_MOUSE 2.21e-14 16_[1(6.60e-17)]_138 -------------------------------------------------------------------------------- ******************************************************************************** ******************************************************************************** Stopped because requested number of motifs (2) found. ******************************************************************************** CPU: Timothys-iMac.rd.unr.edu ********************************************************************************