Query: hypothetical_protein2242|hypothetical_protein2242 [L=131] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 0.0031 17.8 6.9 0.16 12.3 0.9 3.5 3 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) a ------ inclusion threshold ------ 0.037 14.0 0.0 0.063 13.2 0.0 1.5 1 HemS Haemin-degrading HemS.ChuX domain 0.069 12.2 0.0 0.079 12.0 0.0 1.1 1 FUSC-like FUSC-like inner membrane protein yccS 0.094 13.4 0.2 3.3 8.4 0.0 2.1 2 DUF5395 Family of unknown function (DUF5395) 0.1 12.8 0.2 0.17 12.0 0.2 1.4 1 FokI_N Restriction endonuclease FokI, recognition dom Domain annotation for each model (and alignments): >> CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.3 0.2 0.39 1.4e+03 5 18 .. 7 20 .. 5 24 .. 0.76 2 ! 6.5 0.0 0.0028 10 41 61 .. 38 58 .. 31 62 .. 0.86 3 ! 12.3 0.9 4.3e-05 0.16 37 60 .. 101 124 .. 74 127 .. 0.84 Alignments for each domain: == domain 1 score: -0.3 bits; conditional E-value: 0.39 HHHHHHHHHCCTTX CS CBFD_NFYB_HMF 5 iarvkkImksdpda 18 i+ vkk +k+ d+ hypothetical_protein2242|hypothetical_protein2242 7 ISKVKKFIKEKADM 20 57899999998665 PP == domain 2 score: 6.5 bits; conditional E-value: 0.0028 HHHHHHHHCCTTSSCE-HHHH CS CBFD_NFYB_HMF 41 aseAaeickkekrKtikaehi 61 ++ A +++k +rKt+++++ hypothetical_protein2242|hypothetical_protein2242 38 CRDAMAHAQKLGRKTVMGKDF 58 6789999***********996 PP == domain 3 score: 12.3 bits; conditional E-value: 4.3e-05 HHHHHHHHHHHHCCTTSSCE-HHH CS CBFD_NFYB_HMF 37 ieelaseAaeickkekrKtikaeh 60 ++ ++ +A e +k++krKt++ + hypothetical_protein2242|hypothetical_protein2242 101 VQTICLKAIENAKADKRKTVMDRD 124 789*****************9887 PP >> HemS Haemin-degrading HemS.ChuX domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 13.2 0.0 1.8e-05 0.063 63 113 .. 51 107 .. 31 121 .. 0.80 Alignments for each domain: == domain 1 score: 13.2 bits; conditional E-value: 1.8e-05 HemS 63 glvldedidLrlfldqwaeafavkkpt......edgvvtSlqfFdaeGeaihkvfge 113 v+++d++L + ++++ea +v + e g tS q+ d+ + ++ ++ hypothetical_protein2242|hypothetical_protein2242 51 KTVMGKDFNLYVEKSDIQEALVVASKVkklikdELGLSTSSQAIDQLTVRVQTICLK 107 579********************9988677754448888888888877777766655 PP >> FUSC-like FUSC-like inner membrane protein yccS # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 12.0 0.0 2.2e-05 0.079 149 218 .. 35 101 .. 24 123 .. 0.78 Alignments for each domain: == domain 1 score: 12.0 bits; conditional E-value: 2.2e-05 FUSC-like 149 lnaareillsrlkskrgqpetksrrllrlyfvaqDihErassshydYeelreafknsdvl 208 ++a+r+++ ++ k +r +t +++ ++ly++ +Di+E ++++ + ++++++ s+ hypothetical_protein2242|hypothetical_protein2242 35 VKACRDAMAHAQKLGR---KTVMGKDFNLYVEKSDIQEALVVASKVKKLIKDELGLSTSS 91 579********77777...6677789*************999987777777777777666 PP FUSC-like 209 frfqrllelq 218 + +l+ ++ hypothetical_protein2242|hypothetical_protein2242 92 QAIDQLTVRV 101 6665555444 PP >> DUF5395 Family of unknown function (DUF5395) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 8.4 0.0 0.00092 3.3 8 59 .. 8 59 .. 2 63 .. 0.88 2 ? 3.3 0.0 0.036 1.3e+02 13 59 .. 80 126 .. 69 131 .] 0.71 Alignments for each domain: == domain 1 score: 8.4 bits; conditional E-value: 0.00092 DUF5395 8 hdgekWiaeneelvvkgktleeLDenlakelkkrgdfkgksqvevfmkfDye 59 +k+i e+ +++ ++ +e L +++ k+ +++ +++k + m+ D++ hypothetical_protein2242|hypothetical_protein2242 8 SKVKKFIKEKADMNTSAGFFEPLNQDIVKACRDAMAHAQKLGRKTVMGKDFN 59 567899****************************999999888888988875 PP == domain 2 score: 3.3 bits; conditional E-value: 0.036 DUF5395 13 WiaeneelvvkgktleeLDenlak.elkkrgdfkgksqvevfmkfDye 59 i + +l +++ +++L +++ +lk ++ k+ + + m D++ hypothetical_protein2242|hypothetical_protein2242 80 LIKDELGLSTSSQAIDQLTVRVQTiCLKAIENAKAD-KRKTVMDRDFT 126 566667788999999999999988345555555555.77777888874 PP >> FokI_N Restriction endonuclease FokI, recognition domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 12.0 0.2 4.8e-05 0.17 20 77 .. 59 117 .. 45 121 .. 0.85 Alignments for each domain: == domain 1 score: 12.0 bits; conditional E-value: 4.8e-05 FokI_N 20 aifvegskvhrelv.eeklpklvsekdGkkelleelearelsiayaelkGkgtpkgesr 77 ++ve+s++++ lv k++kl++++ G ++ +++++ ++++ lk +k + r hypothetical_protein2242|hypothetical_protein2242 59 NLYVEKSDIQEALVvASKVKKLIKDELGLSTSSQAIDQLTVRVQTICLKAIENAKADKR 117 6799*****99885278**************************9999998877766666 PP