# WARNING: this file is not sorted! # db id alt consensus E-value adj_p-value log_adj_p-value bin_location bin_width total_width sites_in_bin total_sites p_success p-value mult_tests 1 TTTGCATAWCAAWRR MEME-1 TTTGCATAWCAAWRR 6.8e-040 5.7e-041 -92.67 0.0 56 196 288 494 0.28571 5.9e-043 97 1 GTCACCTCATTAGCATAAACTCAGGTGTGR MEME-2 GTCACCTCATTAGCATAAACTCAGGTGTGR 2.2e-001 1.8e-002 -4.01 0.0 123 181 22 22 0.67956 2.0e-004 90 1 GYMVYTAGAARCYRGGTMCAYYCAAWMWKG MEME-3 GYMVYTAGAARCYRGGTMCAYYCAAWMWKG 1.0e0000 8.5e-002 -2.46 0.0 51 181 17 30 0.28177 9.9e-004 90 2 ATGYWAAT DREME-1 ATGCAAAT 7.5e-017 6.3e-018 -39.61 0.0 85 203 195 284 0.41872 6.2e-020 101 2 TGMATAW DREME-2 TGMATAW 1.7e-026 1.4e-027 -61.84 0.0 60 204 180 293 0.29412 1.4e-029 101 2 ACAAWAS DREME-3 ACAAWAS 1.3e-004 1.1e-005 -11.40 0.0 68 204 84 156 0.33333 1.1e-007 101 2 CACSTG DREME-5 CACCTG 8.0e0000 6.6e-001 -0.41 0.0 17 205 19 131 0.08293 1.1e-002 102 2 ATCTRCAT DREME-6 ATCTRCAT 1.7e-005 1.4e-006 -13.49 0.0 67 203 56 89 0.33005 1.4e-008 101 2 CWTTGTC DREME-7 CWTTGTC 2.2e0000 1.8e-001 -1.70 0.0 60 204 38 85 0.29412 2.0e-003 101 2 CCTTTSA DREME-8 CCTTTSA 1.0e0000 8.5e-002 -2.47 0.0 120 204 78 106 0.58824 8.8e-004 101 2 ATGCGCAT DREME-9 ATGCGCAT 6.3e-008 5.2e-009 -19.07 0.0 55 203 35 48 0.27094 5.2e-011 101 ## # Detailed descriptions of columns in this file: # # db: The name of the database (file name) that contains the motif. # id: A name for the motif that is unique in the motif database file. # alt: An alternate name of the motif that may be provided # in the motif database file. # consensus: A consensus sequence computed from the motif. # E-value: The expected number motifs that would have least one. # region as enriched for best matches to the motif as the reported region. # The E-value is the p-value multiplied by the number of motifs in the # input database(s). # adj_p-value: The probability that any tested region would be as enriched for # best matches to this motif as the reported region is. # By default the p-value is calculated by using the one-tailed binomial # test on the number of sequences with a match to the motif # that have their best match in the reported region, corrected for # the number of regions and score thresholds tested. # The test assumes that the probability that the best match in a sequence # falls in the region is the region width divided by the # number of places a motif # can align in the sequence (sequence length minus motif width plus 1). # When CentriMo is run in discriminative mode with a negative # set of sequences, the p-value of a region is calculated # using the Fisher exact test on the # enrichment of best matches in the positive sequences relative # to the negative sequences, corrected # for the number of regions and score thresholds tested. # The test assumes that the probability that the best match (if any) # falls into a given region # is the same for all positive and negative sequences. # log_adj_p-value: Log of adjusted p-value. # bin_location: Location of the center of the most enriched region. # bin_width: The width (in sequence positions) of the most enriched region. # A best match to the motif is counted as being in the region if the # center of the motif falls in the region. # total_width: The window maximal size which can be reached for this motif: # rounded(sequence length - motif length +1)/2 # sites_in_bin: The number of (positive) sequences whose best match to the motif # falls in the reported region. # Note: This number may be less than the number of # (positive) sequences that have a best match in the region. # The reason for this is that a sequence may have many matches that score # equally best. # If n matches have the best score in a sequence, 1/n is added to the # appropriate bin for each match. # total_sites: The number of sequences containing a match to the motif # above the score threshold. # p_success: The probability of falling in the enriched window: # bin width / total width # p-value: The uncorrected p-value before it gets adjusted to the # number of multiple tests to give the adjusted p-value. # mult_tests: This is the number of multiple tests (n) done for this motif. # It was used to correct the original p-value of a region for # multiple tests using the formula: # p' = 1 - (1-p)^n where p is the uncorrected p-value. # The number of multiple tests is the number of regions # considered times the number of score thresholds considered. # It depends on the motif length, sequence length, and the type of # optimizations being done (central enrichment, local enrichment, # score optimization).